Recombinant Human UBL4A protein, GST-tagged
Cat.No. : | UBL4A-3630H |
Product Overview : | Recombinant Human UBL4A protein(1-157 aa), fused to GST tag, was expressed in E. coli. |
Availability | July 04, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-157 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | MQLTVKALQGRECSLQVPEDELVSTLKQLVSEKLNVPVRQQRLLFKGKALADGKRLSDYSIGPNSKLNLVVKPLEKVLLEEGEAQRLADSPPPQVWQLISKVLARHFSAADASRVLEQLQRDYERSLSRLTLDDIERLASRFLHPEVTETMEKGFSK |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | UBL4A ubiquitin-like 4A [ Homo sapiens ] |
Official Symbol | UBL4A |
Synonyms | UBL4A; ubiquitin-like 4A; ubiquitin like 4 , UBL4; ubiquitin-like protein 4A; DXS254E; GDX; GET5; MDY2; TMA24; ubiquitin-like 4; ubiquitin-like protein GDX; G6PD; UBL4; DX254E; |
Gene ID | 8266 |
mRNA Refseq | NM_014235 |
Protein Refseq | NP_055050 |
MIM | 312070 |
UniProt ID | P11441 |
◆ Recombinant Proteins | ||
UBL4A-6065R | Recombinant Rat UBL4A Protein, His (Fc)-Avi-tagged | +Inquiry |
UBL4A-4888R | Recombinant Rhesus Macaque UBL4A Protein, His (Fc)-Avi-tagged | +Inquiry |
UBL4A-5553H | Recombinant Human Ubiquitin-Like 4A, His-tagged | +Inquiry |
UBL4A-5075R | Recombinant Rhesus monkey UBL4A Protein, His-tagged | +Inquiry |
UBL4A-3630H | Recombinant Human UBL4A protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBL4A-554HCL | Recombinant Human UBL4A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UBL4A Products
Required fields are marked with *
My Review for All UBL4A Products
Required fields are marked with *