Recombinant Human UBL4A protein, GST-tagged

• Cat.No.: UBL4A-3630H
• Product Overview: Recombinant Human UBL4A protein(1-157 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-157 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: MQLTVKALQGRECSLQVPEDELVSTLKQLVSEKLNVPVRQQRLLFKGKALADGKRLSDYSIGPNSKLNLVVKPLEKVLLEEGEAQRLADSPPPQVWQLISKVLARHFSAADASRVLEQLQRDYERSLSRLTLDDIERLASRFLHPEVTETMEKGFSK
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: UBL4A ubiquitin-like 4A [ Homo sapiens ]
• Official Symbol: UBL4A
• Synonyms: UBL4A; ubiquitin-like 4A; ubiquitin like 4 , UBL4; ubiquitin-like protein 4A; DXS254E; GDX; GET5; MDY2; TMA24; ubiquitin-like 4; ubiquitin-like protein GDX; G6PD; UBL4; DX254E
• Gene ID: 8266
• mRNA Refseq: NM_014235
• Protein Refseq: NP_055050
• MIM: 312070
• UniProt ID: P11441