Recombinant Human UBL5, His-tagged
Cat.No. : | UBL5-31554TH |
Product Overview : | Recombinant full length Human UBL5 with an N terminal His tag; 93 amino acids with tag, Predicted MWt 10.7 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 73 amino acids |
Description : | Ubiquitin-like proteins (UBLs) are thought to be reversible modulators of protein function rather than protein degraders like ubiquitin (MIM 191339). |
Conjugation : | HIS |
Molecular Weight : | 10.700kDa inclusive of tags |
Tissue specificity : | Ubiquitous. Highest level of expression in heart, skeletal muscle, kidney, liver, iris and lymphoblasts. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0 |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYYQ |
Sequence Similarities : | Contains 1 ubiquitin-like domain. |
Gene Name | UBL5 ubiquitin-like 5 [ Homo sapiens ] |
Official Symbol | UBL5 |
Synonyms | UBL5; ubiquitin-like 5; ubiquitin-like protein 5; |
Gene ID | 59286 |
mRNA Refseq | NM_001048241 |
Protein Refseq | NP_001041706 |
MIM | 606849 |
Uniprot ID | Q9BZL1 |
Chromosome Location | 19p13 |
Function | molecular_function; |
◆ Recombinant Proteins | ||
UBL5-4889R | Recombinant Rhesus Macaque UBL5 Protein, His (Fc)-Avi-tagged | +Inquiry |
UBL5-69H | Recombinant Human Ubiquitin-like 5, His-tagged | +Inquiry |
UBL5-3554H | Recombinant Human UBL5, GST-tagged | +Inquiry |
UBL5-6612H | Recombinant Human UBL5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
UBL5-9850M | Recombinant Mouse UBL5 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBL5-552HCL | Recombinant Human UBL5 293 Cell Lysate | +Inquiry |
UBL5-553HCL | Recombinant Human UBL5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UBL5 Products
Required fields are marked with *
My Review for All UBL5 Products
Required fields are marked with *
0
Inquiry Basket