Recombinant Human UBL5, His-tagged

Cat.No. : UBL5-31554TH
Product Overview : Recombinant full length Human UBL5 with an N terminal His tag; 93 amino acids with tag, Predicted MWt 10.7 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 73 amino acids
Description : Ubiquitin-like proteins (UBLs) are thought to be reversible modulators of protein function rather than protein degraders like ubiquitin (MIM 191339).
Conjugation : HIS
Molecular Weight : 10.700kDa inclusive of tags
Tissue specificity : Ubiquitous. Highest level of expression in heart, skeletal muscle, kidney, liver, iris and lymphoblasts.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYYQ
Sequence Similarities : Contains 1 ubiquitin-like domain.
Gene Name UBL5 ubiquitin-like 5 [ Homo sapiens ]
Official Symbol UBL5
Synonyms UBL5; ubiquitin-like 5; ubiquitin-like protein 5;
Gene ID 59286
mRNA Refseq NM_001048241
Protein Refseq NP_001041706
MIM 606849
Uniprot ID Q9BZL1
Chromosome Location 19p13
Function molecular_function;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UBL5 Products

Required fields are marked with *

My Review for All UBL5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon