Recombinant Human UBL5, His-tagged

• Cat.No.: UBL5-31554TH
• Product Overview: Recombinant full length Human UBL5 with an N terminal His tag; 93 amino acids with tag, Predicted MWt 10.7 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 73 amino acids
• Description: Ubiquitin-like proteins (UBLs) are thought to be reversible modulators of protein function rather than protein degraders like ubiquitin (MIM 191339).
• Conjugation: HIS
• Molecular Weight: 10.700kDa inclusive of tags
• Tissue specificity: Ubiquitous. Highest level of expression in heart, skeletal muscle, kidney, liver, iris and lymphoblasts.
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYYQ
• Sequence Similarities: Contains 1 ubiquitin-like domain.

Gene Information

• Gene Name: UBL5 ubiquitin-like 5 [ Homo sapiens ]
• Official Symbol: UBL5
• Synonyms: UBL5; ubiquitin-like 5; ubiquitin-like protein 5
• Gene ID: 59286
• mRNA Refseq: NM_001048241
• Protein Refseq: NP_001041706
• MIM: 606849
• Uniprot ID: Q9BZL1
• Chromosome Location: 19p13
• Function: molecular_function