Recombinant Human UBL5 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | UBL5-1763H |
Product Overview : | UBL5 MS Standard C13 and N15-labeled recombinant protein (NP_077268) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of a group of proteins similar to ubiquitin. The encoded protein is not thought to degrade proteins like ubiquitin but to affect their function through being bound to target proteins by an isopeptide bond. The gene product has been studied as a link to predisposition to obesity based on its expression in Psammomys obesus, the fat sand rat, which is an animal model for obesity studies. Variation in this gene was found to be significantly associated with some metabolic traits (PMID: 15331561) but not associated with childhood obesity (PMID: 19189687). Pseudogenes of this gene are located on chromosomes 3, 5 and 17. Multiple alternatively spliced variants, encoding the same protein, have been identified. |
Molecular Mass : | 8.5 kDa |
AA Sequence : | MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYYQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | UBL5 ubiquitin-like 5 [ Homo sapiens (human) ] |
Official Symbol | UBL5 |
Synonyms | UBL5; ubiquitin-like 5; ubiquitin-like protein 5; beacon; HUB1; FLJ46917; MGC131795; |
Gene ID | 59286 |
mRNA Refseq | NM_024292 |
Protein Refseq | NP_077268 |
MIM | 606849 |
UniProt ID | Q9BZL1 |
◆ Recombinant Proteins | ||
UBL5-31554TH | Recombinant Human UBL5, His-tagged | +Inquiry |
UBL5-6612H | Recombinant Human UBL5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
UBL5-17748M | Recombinant Mouse UBL5 Protein | +Inquiry |
UBL5-1763H | Recombinant Human UBL5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
UBL5-3554H | Recombinant Human UBL5, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBL5-553HCL | Recombinant Human UBL5 293 Cell Lysate | +Inquiry |
UBL5-552HCL | Recombinant Human UBL5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UBL5 Products
Required fields are marked with *
My Review for All UBL5 Products
Required fields are marked with *
0
Inquiry Basket