Recombinant Human UBL5 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : UBL5-1763H
Product Overview : UBL5 MS Standard C13 and N15-labeled recombinant protein (NP_077268) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of a group of proteins similar to ubiquitin. The encoded protein is not thought to degrade proteins like ubiquitin but to affect their function through being bound to target proteins by an isopeptide bond. The gene product has been studied as a link to predisposition to obesity based on its expression in Psammomys obesus, the fat sand rat, which is an animal model for obesity studies. Variation in this gene was found to be significantly associated with some metabolic traits (PMID: 15331561) but not associated with childhood obesity (PMID: 19189687). Pseudogenes of this gene are located on chromosomes 3, 5 and 17. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Molecular Mass : 8.5 kDa
AA Sequence : MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYYQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name UBL5 ubiquitin-like 5 [ Homo sapiens (human) ]
Official Symbol UBL5
Synonyms UBL5; ubiquitin-like 5; ubiquitin-like protein 5; beacon; HUB1; FLJ46917; MGC131795;
Gene ID 59286
mRNA Refseq NM_024292
Protein Refseq NP_077268
MIM 606849
UniProt ID Q9BZL1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UBL5 Products

Required fields are marked with *

My Review for All UBL5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon