Recombinant Human UBN1 protein, GST-tagged
| Cat.No. : | UBN1-301479H |
| Product Overview : | Recombinant Human UBN1 (592-791 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Met592-His791 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | MAPSKIKVKESSTKPDKKVSVPSGQIGGPIALPSDHQTGGLSIGASSRELPSQASGGLANPPPVNLEDSLDEDLIRNPASSVEAVSKELAALNSRAAGNSEFTLPAPSKAPAEKVGGVLCTEEKRNFAKPSPSAPPPASSLQSPLNFLAEQALALGQSSQEKKPESSGYKELSCQAPLNKGLPEVHQSKAKHHSLPRTSH |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | UBN1 ubinuclein 1 [ Homo sapiens ] |
| Official Symbol | UBN1 |
| Synonyms | UBN1; ubinuclein 1; ubinuclein-1; HIRA-binding protein; ubiquitously expressed nuclear protein; VT; VT4; |
| Gene ID | 29855 |
| mRNA Refseq | NM_001079514 |
| Protein Refseq | NP_001072982 |
| MIM | 609771 |
| UniProt ID | Q9NPG3 |
| ◆ Recombinant Proteins | ||
| UBN1-4891R | Recombinant Rhesus Macaque UBN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| UBN1-301479H | Recombinant Human UBN1 protein, GST-tagged | +Inquiry |
| UBN1-17751M | Recombinant Mouse UBN1 Protein | +Inquiry |
| UBN1-3551C | Recombinant Chicken UBN1 | +Inquiry |
| UBN1-5993Z | Recombinant Zebrafish UBN1 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UBN1 Products
Required fields are marked with *
My Review for All UBN1 Products
Required fields are marked with *
