Recombinant Human UBQLN2, GST-tagged
Cat.No. : | UBQLN2-96H |
Product Overview : | Recombinant Human UBQLN2(1 a.a. - 624 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes an ubiquitin-like protein (ubiquilin) that shares high degree of similarity with related products in yeast, rat and frog. Ubiquilins contain a N-terminal ubiquitin-like domain and a C-terminal ubiquitin-associated domain. They physically associate with both proteasomes and ubiquitin ligases; and thus, are thought to functionally link the ubiquitination machinery to the proteasome to affect in vivo protein degradation. This ubiquilin has also been shown to bind the ATPase domain of the Hsp70-like Stch protein. |
Molecular Mass : | 92.1 kDa |
AA Sequence : | MAENGESSGPPRPSRGPAAAQGSAAAPAEPKIIKVTVKTPKEKEEFAVPENSSVQQFKEAISKRFKSQTDQLVLI FAGKILKDQDTLIQHGIHDGLTVHLVIKSQNRPQGQSTQPSNAAGTNTTSASTPRSNSTPISTNSNPFGLGSLGG LAGLSSLGLSSTNFSELQSQMQQQLMASPEMMIQIMENPFVQSMLSNPDLMRQLIMANPQMQQLIQRNPEISHLL NNPDIMRQTLEIARNPAMMQEMMRNQDLALSNLESIPGGYNALRRMYTDIQEPMLNAAQEQFGGNPFASVGSSSS SGEGTQPSRTENRDPLPNPWAPPPATQSSATTSTTTSTGSGSGNSSSNATGNTVAAANYVASIFSTPGMQSLLQQ ITENPQLIQNMLSAPYMRSMMQSLSQNPDLAAQMMLNSPLFTANPQLQEQMRPQLPAFLQQMQNPDTLSAMSNPR AMQALMQIQQGLQTLATEAPGLIPSFTPGVGVGVLGTAIGPVGPVTPIGPIGPIVPFTPIGPIGPIGPTGPAAPP GSTGSGGPTGPTVSSAAPSETTSPTSESGPNQQFIQQMVQALAGANAPQLPNPEVRFQQQLEQLNAMGFLNREAN LQALIATGGDINAAIERLLGSQPS |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | UBQLN2 ubiquilin 2 [ Homo sapiens ] |
Official Symbol | UBQLN2 |
Synonyms | UBQLN2; ubiquilin 2; ubiquilin-2; Chap1; CHAP1/DSK2; Dsk2; LIC 2; N4BP4; NEDD4 binding protein 4; PLIC 2; PLIC2; RIHFB2157; Nedd4 binding protein 4; ubiquitin-like product Chap1/Dsk2; protein linking IAP with cytoskeleton 2; DSK2; ALS15; CHAP1; HRIHFB2157; FLJ10167; FLJ56541 |
Gene ID | 29978 |
mRNA Refseq | NM_013444 |
Protein Refseq | NP_038472 |
MIM | 300264 |
UniProt ID | Q9UHD9 |
Chromosome Location | Xp11.21 |
Pathway | Protein processing in endoplasmic reticulum |
Function | protein binding |
◆ Recombinant Proteins | ||
UBQLN2-17756M | Recombinant Mouse UBQLN2 Protein | +Inquiry |
UBQLN2-9856M | Recombinant Mouse UBQLN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
UBQLN2-5838H | Recombinant Human UBQLN2 Protein (Ile33-Ala126), N-GST tagged | +Inquiry |
UBQLN2-4644H | Recombinant Human UBQLN2 protein, His-tagged | +Inquiry |
UBQLN2-46H | Recombinant Human UBQLN2 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UBQLN2 Products
Required fields are marked with *
My Review for All UBQLN2 Products
Required fields are marked with *
0
Inquiry Basket