Recombinant Human UBTD1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : UBTD1-3404H
Product Overview : UBTD1 MS Standard C13 and N15-labeled recombinant protein (NP_079230) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The degradation of many proteins is carried out by the ubiquitin pathway in which proteins are targeted for degradation by covalent conjugation of the polypeptide ubiquitin. This gene encodes a protein that belongs to the ubiquitin family of proteins. The encoded protein is thought to regulate E2 ubiquitin conjugating enzymes belonging to the UBE2D family.
Molecular Mass : 25.8 kDa
AA Sequence : MGNCVGRQRRERPAAPGHPRKRAGRNEPLKKERLKWKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAYAAEANDHELAQAILDGASITLPHGTLCECYDELGNRYQLPIYCLSPPVNLLLEHTEEESLEPPEPPPSVRREFPLKVRLSTGKDVRLSASLPDTVGQLKRQLHAQEGIEPSWQRWFFSGKLLTDRTRLQETKIQKDFVIQVIINQPPPPQDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name UBTD1 ubiquitin domain containing 1 [ Homo sapiens (human) ]
Official Symbol UBTD1
Synonyms UBTD1; ubiquitin domain containing 1; ubiquitin domain-containing protein 1; FLJ11807;
Gene ID 80019
mRNA Refseq NM_024954
Protein Refseq NP_079230
MIM 616388
UniProt ID Q9HAC8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UBTD1 Products

Required fields are marked with *

My Review for All UBTD1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon