Recombinant Human UBTD1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | UBTD1-3404H |
Product Overview : | UBTD1 MS Standard C13 and N15-labeled recombinant protein (NP_079230) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The degradation of many proteins is carried out by the ubiquitin pathway in which proteins are targeted for degradation by covalent conjugation of the polypeptide ubiquitin. This gene encodes a protein that belongs to the ubiquitin family of proteins. The encoded protein is thought to regulate E2 ubiquitin conjugating enzymes belonging to the UBE2D family. |
Molecular Mass : | 25.8 kDa |
AA Sequence : | MGNCVGRQRRERPAAPGHPRKRAGRNEPLKKERLKWKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAYAAEANDHELAQAILDGASITLPHGTLCECYDELGNRYQLPIYCLSPPVNLLLEHTEEESLEPPEPPPSVRREFPLKVRLSTGKDVRLSASLPDTVGQLKRQLHAQEGIEPSWQRWFFSGKLLTDRTRLQETKIQKDFVIQVIINQPPPPQDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | UBTD1 ubiquitin domain containing 1 [ Homo sapiens (human) ] |
Official Symbol | UBTD1 |
Synonyms | UBTD1; ubiquitin domain containing 1; ubiquitin domain-containing protein 1; FLJ11807; |
Gene ID | 80019 |
mRNA Refseq | NM_024954 |
Protein Refseq | NP_079230 |
MIM | 616388 |
UniProt ID | Q9HAC8 |
◆ Recombinant Proteins | ||
UBTD1-6413R | Recombinant Rat UBTD1 Protein | +Inquiry |
UBTD1-6069R | Recombinant Rat UBTD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
UBTD1-9861M | Recombinant Mouse UBTD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
UBTD1-4894R | Recombinant Rhesus Macaque UBTD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
UBTD1-3404H | Recombinant Human UBTD1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBTD1-543HCL | Recombinant Human UBTD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UBTD1 Products
Required fields are marked with *
My Review for All UBTD1 Products
Required fields are marked with *
0
Inquiry Basket