Recombinant Human UBTD1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: UBTD1-3404H
• Product Overview: UBTD1 MS Standard C13 and N15-labeled recombinant protein (NP_079230) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The degradation of many proteins is carried out by the ubiquitin pathway in which proteins are targeted for degradation by covalent conjugation of the polypeptide ubiquitin. This gene encodes a protein that belongs to the ubiquitin family of proteins. The encoded protein is thought to regulate E2 ubiquitin conjugating enzymes belonging to the UBE2D family.
• Molecular Mass: 25.8 kDa
• AA Sequence: MGNCVGRQRRERPAAPGHPRKRAGRNEPLKKERLKWKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAYAAEANDHELAQAILDGASITLPHGTLCECYDELGNRYQLPIYCLSPPVNLLLEHTEEESLEPPEPPPSVRREFPLKVRLSTGKDVRLSASLPDTVGQLKRQLHAQEGIEPSWQRWFFSGKLLTDRTRLQETKIQKDFVIQVIINQPPPPQDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: UBTD1 ubiquitin domain containing 1 [ Homo sapiens (human) ]
• Official Symbol: UBTD1
• Synonyms: UBTD1; ubiquitin domain containing 1; ubiquitin domain-containing protein 1; FLJ11807
• Gene ID: 80019
• mRNA Refseq: NM_024954
• Protein Refseq: NP_079230
• MIM: 616388
• UniProt ID: Q9HAC8