Recombinant Human UBTF protein(341-450 aa), C-His-tagged
Cat.No. : | UBTF-2672H |
Product Overview : | Recombinant Human UBTF protein(P17480)(341-450 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 341-450 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | DAYHKKCDQKKKDYEVELLRFLESLPEEEQQRVLGEEKMLNINKKQATSPASKKPAQEGGKGGSEKPKRPVSAMFIFSEEKRRQLQEERPELSESELTRLLARMWNDLSE |
Gene Name | UBTF upstream binding transcription factor, RNA polymerase I [ Homo sapiens ] |
Official Symbol | UBTF |
Synonyms | UBTF; upstream binding transcription factor, RNA polymerase I; nucleolar transcription factor 1; NOR 90; UBF; autoantigen NOR-90; 90-kDa nucleolus organizer region autoantigen; UBF1; UBF-1; NOR-90; |
Gene ID | 7343 |
mRNA Refseq | NM_001076683 |
Protein Refseq | NP_001070151 |
MIM | 600673 |
UniProt ID | P17480 |
◆ Recombinant Proteins | ||
UBTF-2505H | Recombinant Human UBTF Protein (1-670 aa), His-SUMO-tagged | +Inquiry |
UBTF-1408Z | Recombinant Zebrafish UBTF | +Inquiry |
UBTF-2405H | Recombinant Human UBTF protein, His-tagged | +Inquiry |
UBTF-2406H | Recombinant Human UBTF protein, His-SUMO-tagged | +Inquiry |
UBTF-6414R | Recombinant Rat UBTF Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UBTF Products
Required fields are marked with *
My Review for All UBTF Products
Required fields are marked with *
0
Inquiry Basket