Recombinant Human UBTF protein(341-450 aa), C-His-tagged

Cat.No. : UBTF-2672H
Product Overview : Recombinant Human UBTF protein(P17480)(341-450 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 341-450 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : DAYHKKCDQKKKDYEVELLRFLESLPEEEQQRVLGEEKMLNINKKQATSPASKKPAQEGGKGGSEKPKRPVSAMFIFSEEKRRQLQEERPELSESELTRLLARMWNDLSE
Gene Name UBTF upstream binding transcription factor, RNA polymerase I [ Homo sapiens ]
Official Symbol UBTF
Synonyms UBTF; upstream binding transcription factor, RNA polymerase I; nucleolar transcription factor 1; NOR 90; UBF; autoantigen NOR-90; 90-kDa nucleolus organizer region autoantigen; UBF1; UBF-1; NOR-90;
Gene ID 7343
mRNA Refseq NM_001076683
Protein Refseq NP_001070151
MIM 600673
UniProt ID P17480

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UBTF Products

Required fields are marked with *

My Review for All UBTF Products

Required fields are marked with *

0
cart-icon