Recombinant Human UBTF protein(341-450 aa), C-His-tagged

• Cat.No.: UBTF-2672H
• Product Overview: Recombinant Human UBTF protein(P17480)(341-450 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 341-450 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: DAYHKKCDQKKKDYEVELLRFLESLPEEEQQRVLGEEKMLNINKKQATSPASKKPAQEGGKGGSEKPKRPVSAMFIFSEEKRRQLQEERPELSESELTRLLARMWNDLSE

Gene Information

• Gene Name: UBTF upstream binding transcription factor, RNA polymerase I [ Homo sapiens ]
• Official Symbol: UBTF
• Synonyms: UBTF; upstream binding transcription factor, RNA polymerase I; nucleolar transcription factor 1; NOR 90; UBF; autoantigen NOR-90; 90-kDa nucleolus organizer region autoantigen; UBF1; UBF-1; NOR-90
• Gene ID: 7343
• mRNA Refseq: NM_001076683
• Protein Refseq: NP_001070151
• MIM: 600673
• UniProt ID: P17480