Recombinant Human UCHL1 protein, T7/His-tagged

Cat.No. : UCHL1-227H
Product Overview : Recombinant human UCHL1 cDNA (1 – 220 aa, derived from BC005117) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 1-220 a.a.
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Sucrose.
AA Sequence : MASMTGGQQMGRGHHHHHHENLYFQGGEFQLKPMEINPEMLNKVLSRLGVAGQWRFVDVLGLEEESLGSVPAPAC ALLLLFPLTAQHENFRKKQIEELKGQEVSPKVYFMKQTIGNSCGTIGLIHAVANNQDKLGFEDGSVLKQFLSETE KMSPEDRAKCFEKNEAIQAAHDAVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRMPFPVNHGASSEDTLLKDA AKVCREFTEREQGEVRFSAVALC
Purity : >90% by SDS-PAGE
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name UCHL1 ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase) [ Homo sapiens ]
Official Symbol UCHL1
Synonyms UCHL1; ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase); PARK5; ubiquitin carboxyl-terminal hydrolase isozyme L1; PGP9.5; Uch L1; ubiquitin thioesterase L1; neuron cytoplasmic protein 9.5; ubiquitin C-terminal hydrolase; PGP95; Uch-L1; PGP 9.5;
Gene ID 7345
mRNA Refseq NM_004181
Protein Refseq NP_004172
MIM 191342
UniProt ID P09936
Chromosome Location 4p13
Pathway Alpha-synuclein signaling, organism-specific biosystem; Parkinsons disease, organism-specific biosystem;
Function alpha-2A adrenergic receptor binding; cysteine-type endopeptidase activity; ligase activity; omega peptidase activity; peptidase activity; protein binding; ubiquitin binding; ubiquitin thiolesterase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UCHL1 Products

Required fields are marked with *

My Review for All UCHL1 Products

Required fields are marked with *

0
cart-icon