Recombinant Human UCHL1 protein, T7/His-tagged
| Cat.No. : | UCHL1-227H |
| Product Overview : | Recombinant human UCHL1 cDNA (1 – 220 aa, derived from BC005117) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&T7 |
| Protein Length : | 1-220 a.a. |
| Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Sucrose. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFQLKPMEINPEMLNKVLSRLGVAGQWRFVDVLGLEEESLGSVPAPAC ALLLLFPLTAQHENFRKKQIEELKGQEVSPKVYFMKQTIGNSCGTIGLIHAVANNQDKLGFEDGSVLKQFLSETE KMSPEDRAKCFEKNEAIQAAHDAVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRMPFPVNHGASSEDTLLKDA AKVCREFTEREQGEVRFSAVALC |
| Purity : | >90% by SDS-PAGE |
| Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
| Gene Name | UCHL1 ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase) [ Homo sapiens ] |
| Official Symbol | UCHL1 |
| Synonyms | UCHL1; ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase); PARK5; ubiquitin carboxyl-terminal hydrolase isozyme L1; PGP9.5; Uch L1; ubiquitin thioesterase L1; neuron cytoplasmic protein 9.5; ubiquitin C-terminal hydrolase; PGP95; Uch-L1; PGP 9.5; |
| Gene ID | 7345 |
| mRNA Refseq | NM_004181 |
| Protein Refseq | NP_004172 |
| MIM | 191342 |
| UniProt ID | P09936 |
| Chromosome Location | 4p13 |
| Pathway | Alpha-synuclein signaling, organism-specific biosystem; Parkinsons disease, organism-specific biosystem; |
| Function | alpha-2A adrenergic receptor binding; cysteine-type endopeptidase activity; ligase activity; omega peptidase activity; peptidase activity; protein binding; ubiquitin binding; ubiquitin thiolesterase activity; |
| ◆ Cell & Tissue Lysates | ||
| UCHL1-535HCL | Recombinant Human UCHL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UCHL1 Products
Required fields are marked with *
My Review for All UCHL1 Products
Required fields are marked with *
