Recombinant Human UCP1 protein, His-tagged
| Cat.No. : | UCP1-2916H |
| Product Overview : | Recombinant Human UCP1 protein(1-307 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 16, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-307 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MGGLTASDVHPTLGVQLFSAGIAACLADVITFPLDTAKVRLQVQGECPTSSVIRYKGVLGTITAVVKTEGRMKLYSGLPAGLQRQISSASLRIGLYDTVQEFLTAGKETAPSLGSKILAGLTTGGVAVFIGQPTEVVKVRLQAQSHLHGIKPRYTGTYNAYRIIATTEGLTGLWKGTTPNLMRSVIINCTELVTYDLMKEAFVKNNILADDVPCHLVSALIAGFCATAMSSPVDVVKTRFINSPPGQYKSVPNCAMKVFTNEGPTAFFKGLVPSFLRLGSWNVIMFVCFEQLKRELSKSRQTMDCAT |
| Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | UCP1 uncoupling protein 1 (mitochondrial, proton carrier) [ Homo sapiens ] |
| Official Symbol | UCP1 |
| Synonyms | UCP1; uncoupling protein 1 (mitochondrial, proton carrier); UCP; mitochondrial brown fat uncoupling protein 1; SLC25A7; thermogenin; solute carrier family 25 member 7; |
| Gene ID | 7350 |
| mRNA Refseq | NM_021833 |
| Protein Refseq | NP_068605 |
| MIM | 113730 |
| UniProt ID | P25874 |
| ◆ Recombinant Proteins | ||
| UCP1-9872M | Recombinant Mouse UCP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| UCP1-20M | Recombinant Mouse Ucp1 protein, His-tagged | +Inquiry |
| UCP1-12M | Recombinant Mouse UCP1 protein, His-tagged | +Inquiry |
| RFL7527CF | Recombinant Full Length Dog Mitochondrial Brown Fat Uncoupling Protein 1(Ucp1) Protein, His-Tagged | +Inquiry |
| UCP1-27R | Recombinant Rat UCP1 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| UCP1-526HCL | Recombinant Human UCP1 293 Cell Lysate, Flag-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UCP1 Products
Required fields are marked with *
My Review for All UCP1 Products
Required fields are marked with *
