Recombinant Human UFC1, His-tagged
| Cat.No. : | UFC1-30871TH |
| Product Overview : | Recombinant full length Human UFC1 with an N terminal His tag; 187 amino acids, predicted MWt 21.6kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 167 amino acids |
| Description : | UFC1 is an E2-like conjugating enzyme for ubiquitin-fold modifier-1 (UFM1; MIM 610553) (Komatsu et al. |
| Conjugation : | HIS |
| Molecular Weight : | 21.600kDa inclusive of tags |
| Form : | Liquid |
| Purity : | >90% by SDS-PAGE |
| Storage buffer : | Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0 |
| Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMADEATRRVVSEIPVLKTNAGPRDRELWVQRLKEEYQSLIRYVENNKNADNDWFRLESNKEGTRWFGKCWYIHDLLKYEFDIEFDIPITYPTTAPEIAVPELDGKTAKMYRGGKICLTDHFKPLWARNVPKFGLAHLMALGLGPWLAVEIPDLIQKGVIQHKEKCNQ |
| Sequence Similarities : | Belongs to the ubiquitin-conjugating enzyme family. UFC1 subfamily. |
| Gene Name | UFC1 ubiquitin-fold modifier conjugating enzyme 1 [ Homo sapiens ] |
| Official Symbol | UFC1 |
| Synonyms | UFC1; ubiquitin-fold modifier conjugating enzyme 1; ubiquitin-fold modifier-conjugating enzyme 1; HSPC155; |
| Gene ID | 51506 |
| mRNA Refseq | NM_016406 |
| Protein Refseq | NP_057490 |
| MIM | 610554 |
| Uniprot ID | Q9Y3C8 |
| Chromosome Location | 1q23.3 |
| Function | UFM1 conjugating enzyme activity; protein binding; |
| ◆ Recombinant Proteins | ||
| UFC1-30871TH | Recombinant Human UFC1, His-tagged | +Inquiry |
| UFC1-17793M | Recombinant Mouse UFC1 Protein | +Inquiry |
| UFC1-4367H | Recombinant Human UFC1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| UFC1-0406H | Recombinant Human UFC1 Protein (A2-Q167), Tag Free | +Inquiry |
| UFC1-1069Z | Recombinant Zebrafish UFC1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| UFC1-522HCL | Recombinant Human UFC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UFC1 Products
Required fields are marked with *
My Review for All UFC1 Products
Required fields are marked with *
