Recombinant Human UFC1, His-tagged

Cat.No. : UFC1-30871TH
Product Overview : Recombinant full length Human UFC1 with an N terminal His tag; 187 amino acids, predicted MWt 21.6kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 167 amino acids
Description : UFC1 is an E2-like conjugating enzyme for ubiquitin-fold modifier-1 (UFM1; MIM 610553) (Komatsu et al.
Conjugation : HIS
Molecular Weight : 21.600kDa inclusive of tags
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMADEATRRVVSEIPVLKTNAGPRDRELWVQRLKEEYQSLIRYVENNKNADNDWFRLESNKEGTRWFGKCWYIHDLLKYEFDIEFDIPITYPTTAPEIAVPELDGKTAKMYRGGKICLTDHFKPLWARNVPKFGLAHLMALGLGPWLAVEIPDLIQKGVIQHKEKCNQ
Sequence Similarities : Belongs to the ubiquitin-conjugating enzyme family. UFC1 subfamily.
Gene Name UFC1 ubiquitin-fold modifier conjugating enzyme 1 [ Homo sapiens ]
Official Symbol UFC1
Synonyms UFC1; ubiquitin-fold modifier conjugating enzyme 1; ubiquitin-fold modifier-conjugating enzyme 1; HSPC155;
Gene ID 51506
mRNA Refseq NM_016406
Protein Refseq NP_057490
MIM 610554
Uniprot ID Q9Y3C8
Chromosome Location 1q23.3
Function UFM1 conjugating enzyme activity; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UFC1 Products

Required fields are marked with *

My Review for All UFC1 Products

Required fields are marked with *

0
cart-icon
0
compare icon