Recombinant Human UGDH protein, His-tagged

Cat.No. : UGDH-3266H
Product Overview : Recombinant Human UGDH protein(1-301 aa), fused to His tag, was expressed in E. coli.
Availability July 30, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-301 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : MFEIKKICCIGAGYVGGPTCSVIAHMCPEIRVTVVDVNESRINAWNSPTLPIYEPGLKEVVESCRGKNLFFSTNIDDAIKEADLVFISVNTPTKTYGMGKGRAADLKYIEACARRIVQNSNGYKIVTEKSTVPVRAAESIRRIFDANTKPNLNLQVLSNPEFLAEGTAIKDLKNPDRVLIGGDETPEGQRAVQALCAVYEHWVPREKILTTNTWSSELSKLAANAFLAQRISSINSISALCEATGADVEEVATAIGMDQRIGNKFLKASVGFGGSCFQKDVLNLVYLCEALNLPEVARYWQ
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name UGDH UDP-glucose 6-dehydrogenase [ Homo sapiens ]
Official Symbol UGDH
Synonyms UGDH; UDP-glucose 6-dehydrogenase; UDP glucose dehydrogenase; UDP-Glc dehydrogenase; UDP-glucose dehydrogenase; uridine diphospho-glucose dehydrogenase; GDH; UGD; UDPGDH; UDP-GlcDH;
Gene ID 7358
mRNA Refseq NM_001184700
Protein Refseq NP_001171629
MIM 603370
UniProt ID O60701

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UGDH Products

Required fields are marked with *

My Review for All UGDH Products

Required fields are marked with *

0
cart-icon