Recombinant Human UGGT1 protein, His-tagged
Cat.No. : | UGGT1-5744H |
Product Overview : | Recombinant Human UGGT1 protein(1221-1531 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1221-1531 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | TEEVKQDKDDIINIFSVASGHLYERFLRIMMLSVLKNTKTPVKFWFLKNYLSPTFKEFIPYMANEYNFQYELVQYKWPRWLHQQTEKQRIIWGYKILFLDVLFPLVVDKFLFVDADQIVRTDLKELRDFNLDGAPYGYTPFCDSRREMDGYRFWKSGYWASHLAGRKYHISALYVVDLKKFRKIAAGDRLRGQYQGLSQDPNSLSNLDQDLPNNMIHQVPIKSLPQEWLWCETWCDDASKKRAKTIDLCNNPMTKEPKLEAAVRIVPEWQDYDQEIKQLQIRFQKEKETGALYKEKTKEPSREGPQKREEL |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | UGGT1 UDP-glucose glycoprotein glucosyltransferase 1 [ Homo sapiens ] |
Official Symbol | UGGT1 |
Synonyms | UGGT1; UDP-glucose glycoprotein glucosyltransferase 1; UDP glucose ceramide glucosyltransferase like 1 , UGCGL1; UDP-glucose:glycoprotein glucosyltransferase 1; HUGT1; UDP--Glc:glycoprotein glucosyltransferase; UDP-glucose ceramide glucosyltransferase-like 1; UGT1; UGCGL1; FLJ21763; FLJ23671; FLJ23796; |
Gene ID | 56886 |
mRNA Refseq | NM_020120 |
Protein Refseq | NP_064505 |
MIM | 605897 |
UniProt ID | Q9NYU2 |
◆ Recombinant Proteins | ||
UGGT1-6032H | Recombinant Human UGGT1 Protein (Leu1221-Leu1536), N-His tagged | +Inquiry |
UGGT1-6087R | Recombinant Rat UGGT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
UGGT1-6431R | Recombinant Rat UGGT1 Protein | +Inquiry |
UGGT1-5744H | Recombinant Human UGGT1 protein, His-tagged | +Inquiry |
UGGT1-1651H | Recombinant Human UGGT1 protein, His & T7-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UGGT1 Products
Required fields are marked with *
My Review for All UGGT1 Products
Required fields are marked with *