Recombinant Human UGT1A7

Cat.No. : UGT1A7-31664TH
Product Overview : Recombinant full length UGT1A7 protein (Human)
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5 exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The enzyme encoded by this gene has moderate glucuronidase activity with phenols.
Tissue specificity : Liver and gastric tissue.
Biological activity : Vial Content: 5 mg protein.concentration 2-20 mg/mL protein
Form : Liquid
Storage buffer : Preservative: NoneConstituents: 20% Glycerol, 100mM Potassium phosphate, 1mM DTT, 0.1mM EDTA, pH 7.4
Storage : Aliquot and store at -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MARAGWTGLLPLYVCLLLTCGFAKAGKLLVVPMDGSHWFT MQSVVEKLILRGHEVVVVMPEVSWQLGRSLNCTVKTYSTS YTLEDQDREFMVFADARWTAPLRSAFSLLTSSSNGIFDLF FSNCRSLFNDRKLVEYLKESCFDAVFLDPFDACGLIVAKY FSLPSVVFARGIFCHYLEEGAQCPAPLSYVPRLLLGFSDA MTFKERVWNHIMHLEEHLFCPYFFKNVLEIASEILQTPVT AYDLYSHTSIWLLRTDFVLEYPKPVMPNMIFIGGINCHQG KPVPMEFEAYINASGEHGIVVFSLGSMVSEIPEKKAMAIA DALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDLLGH PMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKR METKGAGVTLNVLEMTSEDLENALKAVINDKSYKENIMRL SSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTW YQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGR VKKAHKSKTH
Sequence Similarities : Belongs to the UDP-glycosyltransferase family.
Gene Name : UGT1A7 UDP glucuronosyltransferase 1 family, polypeptide A7 [ Homo sapiens ]
Official Symbol : UGT1A7
Synonyms : UGT1A7; UDP glucuronosyltransferase 1 family, polypeptide A7; UDP glycosyltransferase 1 family, polypeptide A6; UDP-glucuronosyltransferase 1-7; UGT1G;
Gene ID : 54577
mRNA Refseq : NM_019077
Protein Refseq : NP_061950
MIM : 606432
Uniprot ID : Q9HAW7
Chromosome Location : 2q37
Pathway : Ascorbate and aldarate metabolism, organism-specific biosystem; Ascorbate and aldarate metabolism, conserved biosystem; Ascorbate biosynthesis, animals, glucose-1P => ascorbate, organism-specific biosystem; Ascorbate biosynthesis, animals, glucose-1P =>
Function : drug binding; enzyme binding; enzyme inhibitor activity; glucuronosyltransferase activity; protein heterodimerization activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All UGT1A7 Products

Required fields are marked with *

My Review for All UGT1A7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /
  • Service lnquiry:

Stay Updated on the Latest Bioscience Trends