Recombinant Human UGT2B4 protein, His-tagged

Cat.No. : UGT2B4-3519H
Product Overview : Recombinant Human UGT2B4 protein(169-528 aa), fused to His tag, was expressed in E. coli.
Availability June 18, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 169-528 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : VYSLRFSPGYAIEKHSGGLLFPPSYVPVVMSELSDQMTFIERVKNMIYVLYFEFWFQIFDMKKWDQFYSEVLGRPTTLSETMAKADIWLIRNYWDFQFPHPLLPNVEFVGGLHCKPAKPLPKEMEEFVQSSGENGVVVFSLGSMVSNTSEERANVIASALAKIPQKVLWRFDGNKPDTLGLNTRLYKWIPQNDLLGHPKTRAFITHGGANGIYEAIYHGIPMVGVPLFADQPDNIAHMKAKGAAVSLDFHTMSSTDLLNALKTVINDPLYKENAMKLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHDLTWFQYHSLDVTGFLLACVATVIFIITKCLFCVWKFVRTGKKGKRD
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name UGT2B4 UDP glucuronosyltransferase 2 family, polypeptide B4 [ Homo sapiens ]
Official Symbol UGT2B4
Synonyms UGT2B4; UDP glucuronosyltransferase 2 family, polypeptide B4; UDP glycosyltransferase 2 family, polypeptide B4; UDP-glucuronosyltransferase 2B4; UGT2B11; UDPGTh-1; UDPGT 2B4; hyodeoxycholic acid; UDP glucuronosyltransferase 2B4; hyodeoxycholic acid-specific UDPGT; UDP-glucuronyltransferase, family 2, beta-4; HLUG25; UDPGTH1; UDPGT2B4;
Gene ID 7363
mRNA Refseq NM_021139
Protein Refseq NP_066962
MIM 600067
UniProt ID P06133

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UGT2B4 Products

Required fields are marked with *

My Review for All UGT2B4 Products

Required fields are marked with *

0
cart-icon
0
compare icon