Recombinant Human UGT2B7, GST-tagged
Cat.No. : | UGT2B7-209H |
Product Overview : | Recombinant Human UGT2B7(1 a.a. - 529 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene belongs to the UDP-glycosyltransferase (UGT) family. UGTs serve a major role in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. This protein is localized in the microsome membrane, and has unique specificity for 3,4-catechol estrogens and estriol, suggesting that it may play an important role in regulating the level and activity of these potent estrogen metabolites. |
Molecular Mass : | 84.59 kDa |
AA Sequence : | MSVKWTSVILLIQLSFCFSSGNCGKVLVWAAEYSHWMNIKTILDELIQRGHEVTVLASSASILFDPNNSSALKIE IYPTSLTKTELENFIMQQIKRWSDLPKDTFWLYFSQVQEIMSIFGDITRKFCKDVVSNKKFMKKVQESRFDVIFA DAIFPCSELLAELFNIPFVYSLSFSPGYTFEKHSGGFIFPPSYVPVVMSELTDQMTFMERVKNMIYVLYFDFWFE IFDMKKWDQFYSEVLGRPTTLSETMGKADVWLIRNSWNFQFPYPLLPNVDFVGGLHCKPAKPLPKEMEDFVQSSG ENGVVVFSLGSMVSNMTEERANVIASALAQIPQKVLWRFDGNKPDTLGLNTRLYKWIPQNDLLGHPKTRAFITHG GANGIYEAIYHGIPMVGIPLFADQPDNIAHMKARGAAVRVDFNTMSSTDLLNALKRVINDPSYKENVMKLSRIQH DQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHDLTWFQYHSLDVIGFLLVCVATVIFIVTKCCLFCFWKFARKAKK GKND |
Applications : | ELISA; WB-Re; AP; Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | UGT2B7 UDP glucuronosyltransferase 2 family, polypeptide B7 [ Homo sapiens (human) ] |
Official Symbol | UGT2B7 |
Synonyms | UGT2B7; UDP glucuronosyltransferase 2 family, polypeptide B7; UDP glycosyltransferase 2 family, polypeptide B7; UDP-glucuronosyltransferase 2B7; UGT2B9; 3 4 catechol estrogen specific; UDP glucuronosyltransferase 2 family polypeptide B7; UDP glucuronosyltransferase 2B7; UDP glucuronyltransferase family 2 beta 7; UDP glycosyltransferase 2 family polypeptide B7; UDPGT; UDPGTh 2; UDPGTh2; UGT2B9; UGTB2B9; UDPGTh-2; UDPGT 2B7; 3,4-catechol estrogen specific; UDP glucuronosyltransferase 2B7; UDP-glucuronosyltransferase 2B9; 3,4-catechol estrogen-specific UDPGT; UDP-glucuronyltransferase, family 2, beta-7; UDPGTH2; UDPGT2B7; UDPGT 2B9 |
Gene ID | 7364 |
mRNA Refseq | NM_001074 |
Protein Refseq | NP_001065 |
MIM | 600068 |
UniProt ID | P16662 |
Chromosome Location | 4q13 |
Pathway | Ascorbate and aldarate metabolism; Chemical carcinogenesis; Codeine and morphine metabolism |
Function | glucuronosyltransferase activity; NOT retinoic acid binding |
◆ Recombinant Proteins | ||
UGT2B7-209H | Recombinant Human UGT2B7, GST-tagged | +Inquiry |
UGT2B7-6436R | Recombinant Rat UGT2B7 Protein | +Inquiry |
RFL23893HF | Recombinant Full Length Human Udp-Glucuronosyltransferase 2B7(Ugt2B7) Protein, His-Tagged | +Inquiry |
Ugt2b7-604R | Recombinant Rat Ugt2b7 Protein, His-tagged | +Inquiry |
UGT2B7-542HF | Recombinant Full Length Human UGT2B7 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UGT2B7 Products
Required fields are marked with *
My Review for All UGT2B7 Products
Required fields are marked with *