Recombinant Human UGT2B7, GST-tagged

Cat.No. : UGT2B7-209H
Product Overview : Recombinant Human UGT2B7(1 a.a. - 529 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene belongs to the UDP-glycosyltransferase (UGT) family. UGTs serve a major role in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. This protein is localized in the microsome membrane, and has unique specificity for 3,4-catechol estrogens and estriol, suggesting that it may play an important role in regulating the level and activity of these potent estrogen metabolites.
Molecular Mass : 84.59 kDa
AA Sequence : MSVKWTSVILLIQLSFCFSSGNCGKVLVWAAEYSHWMNIKTILDELIQRGHEVTVLASSASILFDPNNSSALKIE IYPTSLTKTELENFIMQQIKRWSDLPKDTFWLYFSQVQEIMSIFGDITRKFCKDVVSNKKFMKKVQESRFDVIFA DAIFPCSELLAELFNIPFVYSLSFSPGYTFEKHSGGFIFPPSYVPVVMSELTDQMTFMERVKNMIYVLYFDFWFE IFDMKKWDQFYSEVLGRPTTLSETMGKADVWLIRNSWNFQFPYPLLPNVDFVGGLHCKPAKPLPKEMEDFVQSSG ENGVVVFSLGSMVSNMTEERANVIASALAQIPQKVLWRFDGNKPDTLGLNTRLYKWIPQNDLLGHPKTRAFITHG GANGIYEAIYHGIPMVGIPLFADQPDNIAHMKARGAAVRVDFNTMSSTDLLNALKRVINDPSYKENVMKLSRIQH DQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHDLTWFQYHSLDVIGFLLVCVATVIFIVTKCCLFCFWKFARKAKK GKND
Applications : ELISA; WB-Re; AP; Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name UGT2B7 UDP glucuronosyltransferase 2 family, polypeptide B7 [ Homo sapiens (human) ]
Official Symbol UGT2B7
Synonyms UGT2B7; UDP glucuronosyltransferase 2 family, polypeptide B7; UDP glycosyltransferase 2 family, polypeptide B7; UDP-glucuronosyltransferase 2B7; UGT2B9; 3 4 catechol estrogen specific; UDP glucuronosyltransferase 2 family polypeptide B7; UDP glucuronosyltransferase 2B7; UDP glucuronyltransferase family 2 beta 7; UDP glycosyltransferase 2 family polypeptide B7; UDPGT; UDPGTh 2; UDPGTh2; UGT2B9; UGTB2B9; UDPGTh-2; UDPGT 2B7; 3,4-catechol estrogen specific; UDP glucuronosyltransferase 2B7; UDP-glucuronosyltransferase 2B9; 3,4-catechol estrogen-specific UDPGT; UDP-glucuronyltransferase, family 2, beta-7; UDPGTH2; UDPGT2B7; UDPGT 2B9
Gene ID 7364
mRNA Refseq NM_001074
Protein Refseq NP_001065
MIM 600068
UniProt ID P16662
Chromosome Location 4q13
Pathway Ascorbate and aldarate metabolism; Chemical carcinogenesis; Codeine and morphine metabolism
Function glucuronosyltransferase activity; NOT retinoic acid binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UGT2B7 Products

Required fields are marked with *

My Review for All UGT2B7 Products

Required fields are marked with *

0
cart-icon