Recombinant Human VAC14, His-tagged

Cat.No. : VAC14-29818TH
Product Overview : Recombinant fragment, corresponding to amino acids 640-782 of Human VAC14 with N terminal His tag; 143 amino acids, 18kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 640-782 a.a.
Description : The content of phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2) in endosomal membranes changes dynamically with fission and fusion events that generate or absorb intracellular transport vesicles. VAC14 is a component of a trimolecular complex that tightly regulates the level of PtdIns(3,5)P2. Other components of this complex are the PtdIns(3,5)P2-synthesizing enzyme PIKFYVE (MIM 609414) and the PtdIns(3,5)P2 phosphatase FIG4 (MIM 609390). VAC14 functions as an activator of PIKFYVE (Sbrissa et al.
Conjugation : HIS
Tissue specificity : Ubiquitously expressed.
Form : Lyophilised:Reconstitute with 82 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : QNYRHAYDLIQKFGDLEVTVDFLAEVDKLVQLIECPIFTY LRLQLLDVKNNPYLIKALYGLLMLLPQSSAFQLLSHRL QCVPNPELLQTEDSLKAAPKSQKADSPSIDYAELLQHF EKVQNKHLEVRHQRSGRGDHLDRRVVL
Sequence Similarities : Belongs to the VAC14 family.Contains 6 HEAT repeats.
Gene Name VAC14 Vac14 homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol VAC14
Synonyms VAC14; Vac14 homolog (S. cerevisiae); Tax1 (human T cell leukemia virus type I) binding protein 2 , TAX1BP2; protein VAC14 homolog; ArPIKfyve; FLJ10305;
Gene ID 55697
mRNA Refseq NM_018052
Protein Refseq NP_060522
MIM 604632
Uniprot ID Q08AM6
Chromosome Location 16q22.1
Pathway HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem;
Function binding; receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All VAC14 Products

Required fields are marked with *

My Review for All VAC14 Products

Required fields are marked with *

0
cart-icon
0
compare icon