Recombinant Human VAC14, His-tagged
Cat.No. : | VAC14-29818TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 640-782 of Human VAC14 with N terminal His tag; 143 amino acids, 18kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 640-782 a.a. |
Description : | The content of phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2) in endosomal membranes changes dynamically with fission and fusion events that generate or absorb intracellular transport vesicles. VAC14 is a component of a trimolecular complex that tightly regulates the level of PtdIns(3,5)P2. Other components of this complex are the PtdIns(3,5)P2-synthesizing enzyme PIKFYVE (MIM 609414) and the PtdIns(3,5)P2 phosphatase FIG4 (MIM 609390). VAC14 functions as an activator of PIKFYVE (Sbrissa et al. |
Conjugation : | HIS |
Tissue specificity : | Ubiquitously expressed. |
Form : | Lyophilised:Reconstitute with 82 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | QNYRHAYDLIQKFGDLEVTVDFLAEVDKLVQLIECPIFTY LRLQLLDVKNNPYLIKALYGLLMLLPQSSAFQLLSHRL QCVPNPELLQTEDSLKAAPKSQKADSPSIDYAELLQHF EKVQNKHLEVRHQRSGRGDHLDRRVVL |
Sequence Similarities : | Belongs to the VAC14 family.Contains 6 HEAT repeats. |
Gene Name | VAC14 Vac14 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | VAC14 |
Synonyms | VAC14; Vac14 homolog (S. cerevisiae); Tax1 (human T cell leukemia virus type I) binding protein 2 , TAX1BP2; protein VAC14 homolog; ArPIKfyve; FLJ10305; |
Gene ID | 55697 |
mRNA Refseq | NM_018052 |
Protein Refseq | NP_060522 |
MIM | 604632 |
Uniprot ID | Q08AM6 |
Chromosome Location | 16q22.1 |
Pathway | HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem; |
Function | binding; receptor activity; |
◆ Recombinant Proteins | ||
VAC14-1514HFL | Recombinant Full Length Human VAC14 Protein, C-Flag-tagged | +Inquiry |
Vac14-6890M | Recombinant Mouse Vac14 Protein, Myc/DDK-tagged | +Inquiry |
VAC14-2278C | Recombinant Chicken VAC14 | +Inquiry |
VAC14-2331H | Recombinant Human VAC14 Protein, His (Fc)-Avi-tagged | +Inquiry |
VAC14-02H | Recombinant Human VAC14 Protein (1-782), N-GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
VAC14-1901HCL | Recombinant Human VAC14 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All VAC14 Products
Required fields are marked with *
My Review for All VAC14 Products
Required fields are marked with *
0
Inquiry Basket