Recombinant Human ULBP2 protein, His-tagged
Cat.No. : | ULBP2-4018H |
Product Overview : | Recombinant Human ULBP2 protein(25-224 aa), fused to His tag, was expressed in E. coli. |
Availability | July 02, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 25-224 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | AGRADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLRDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLLFDSEKRMWTTVHPGARKMKEKWENDKVVAMSFHYFSMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSSGTTQLRA |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ULBP2 UL16 binding protein 2 [ Homo sapiens ] |
Official Symbol | ULBP2 |
Synonyms | ULBP2; UL16 binding protein 2; NKG2D ligand 2; RAET1H; N2DL-2; NKG2DL2; ALCAN-alpha; UL16-binding protein 2; retinoic acid early transcript 1H; retinoic acid early transcript 1 H; N2DL2; |
Gene ID | 80328 |
mRNA Refseq | NM_025217 |
Protein Refseq | NP_079493 |
MIM | 605698 |
UniProt ID | Q9BZM5 |
◆ Recombinant Proteins | ||
ULBP2-449HAF488 | Recombinant Human ULBP2 Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
ULBP2-449HAF647 | Recombinant Human ULBP2 Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
ULBP2-1286H | Active Recombinant Human ULBP2 protein, His-tagged | +Inquiry |
ULBP2-051H | Recombinant Human ULBP2 protein, His-Avi-tagged, Biotinylated | +Inquiry |
ULBP2-449HAF555 | Recombinant Human ULBP2 Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
ULBP2-1791HCL | Recombinant Human ULBP2 cell lysate | +Inquiry |
ULBP2-1790HCL | Recombinant Human ULBP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ULBP2 Products
Required fields are marked with *
My Review for All ULBP2 Products
Required fields are marked with *