Recombinant Human UMPS protein, His-tagged

• Cat.No.: UMPS-3595H
• Product Overview: Recombinant Human UMPS protein(189-480 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E. coli
• Tag: His
• Protein Length: 189-480 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
• AASequence: VDAETVGRVKRFIQENVFVAANHNGSPLSIKEAPKELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLGV
• Purity: 90%, by SDS-PAGE.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: UMPS uridine monophosphate synthetase [ Homo sapiens ]
• Official Symbol: UMPS
• Synonyms: UMPS; uridine monophosphate synthetase; uridine 5-monophosphate synthase; orotate phosphoribosyl transferase and orotidine 5 decarboxylase; OPRTase; OMPdecase; UMP synthase; orotate phosphoribosyltransferase; orotidine 5-phosphate decarboxylase; OPRT
• mRNA Refseq: NM_000373
• Protein Refseq: NP_000364
• MIM: 613891
• UniProt ID: P11172
• Gene ID: 7372