Recombinant Human UMPS protein, His-tagged
| Cat.No. : | UMPS-3595H | 
| Product Overview : | Recombinant Human UMPS protein(189-480 aa), fused with N-terminal His tag, was expressed in E. coli. | 
| Availability | November 04, 2025 | 
| Unit | |
| Price | |
| Qty | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | E. coli | 
| Tag : | His | 
| Protein Length : | 189-480 aa | 
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. | 
| AASequence : | VDAETVGRVKRFIQENVFVAANHNGSPLSIKEAPKELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLGV | 
| Purity : | 90%, by SDS-PAGE. | 
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. | 
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. | 
| Gene Name | UMPS uridine monophosphate synthetase [ Homo sapiens ] | 
| Official Symbol | UMPS | 
| Synonyms | UMPS; uridine monophosphate synthetase; uridine 5-monophosphate synthase; orotate phosphoribosyl transferase and orotidine 5 decarboxylase; OPRTase; OMPdecase; UMP synthase; orotate phosphoribosyltransferase; orotidine 5-phosphate decarboxylase; OPRT; | 
| mRNA Refseq | NM_000373 | 
| Protein Refseq | NP_000364 | 
| MIM | 613891 | 
| UniProt ID | P11172 | 
| Gene ID | 7372 | 
| ◆ Recombinant Proteins | ||
| UMPS-5104R | Recombinant Rhesus monkey UMPS Protein, His-tagged | +Inquiry | 
| Umps-7928M | Recombinant Mouse Umps protein, His & T7-tagged | +Inquiry | 
| UMPS-349H | Recombinant Human uridine monophosphate synthetase, His-tagged | +Inquiry | 
| UMPS-3314H | Recombinant Human UMPS Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| UMPS-301620H | Recombinant Human UMPS protein, GST-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| UMPS-503HCL | Recombinant Human UMPS 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All UMPS Products
Required fields are marked with *
My Review for All UMPS Products
Required fields are marked with *
  
        
    
      
            