Recombinant Human UMPS protein, His-tagged
Cat.No. : | UMPS-3595H |
Product Overview : | Recombinant Human UMPS protein(189-480 aa), fused with N-terminal His tag, was expressed in E. coli. |
Availability | October 11, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | His |
Protein Length : | 189-480 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | VDAETVGRVKRFIQENVFVAANHNGSPLSIKEAPKELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLGV |
Purity : | 90%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | UMPS uridine monophosphate synthetase [ Homo sapiens ] |
Official Symbol | UMPS |
Synonyms | UMPS; uridine monophosphate synthetase; uridine 5-monophosphate synthase; orotate phosphoribosyl transferase and orotidine 5 decarboxylase; OPRTase; OMPdecase; UMP synthase; orotate phosphoribosyltransferase; orotidine 5-phosphate decarboxylase; OPRT; |
mRNA Refseq | NM_000373 |
Protein Refseq | NP_000364 |
MIM | 613891 |
UniProt ID | P11172 |
Gene ID | 7372 |
◆ Recombinant Proteins | ||
UMPS-5104R | Recombinant Rhesus monkey UMPS Protein, His-tagged | +Inquiry |
Umps-7928M | Recombinant Mouse Umps protein, His & T7-tagged | +Inquiry |
UMPS-349H | Recombinant Human uridine monophosphate synthetase, His-tagged | +Inquiry |
UMPS-3314H | Recombinant Human UMPS Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
UMPS-301620H | Recombinant Human UMPS protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UMPS-503HCL | Recombinant Human UMPS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UMPS Products
Required fields are marked with *
My Review for All UMPS Products
Required fields are marked with *