Recombinant Human UMPS protein, GST-tagged
Cat.No. : | UMPS-301620H |
Product Overview : | Recombinant Human UMPS (189-480 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Val189-Val480 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization |
AA Sequence : | VDAETVGRVKRFIQENVFVAANHNGSPLSIKEAPKELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLGV |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | UMPS uridine monophosphate synthetase [ Homo sapiens ] |
Official Symbol | UMPS |
Synonyms | UMPS; uridine monophosphate synthetase; uridine 5-monophosphate synthase; orotate phosphoribosyl transferase and orotidine 5 decarboxylase; OPRTase; OMPdecase; UMP synthase; orotate phosphoribosyltransferase; orotidine 5-phosphate decarboxylase; OPRT; |
Gene ID | 7372 |
mRNA Refseq | NM_000373 |
Protein Refseq | NP_000364 |
MIM | 613891 |
UniProt ID | P11172 |
◆ Recombinant Proteins | ||
UMPS-339HFL | Active Recombinant Full Length Human UMPS Protein, C-Flag-tagged | +Inquiry |
UMPS-212H | Recombinant Human UMPS Protein, His-tagged | +Inquiry |
UMPS-349H | Recombinant Human uridine monophosphate synthetase, His-tagged | +Inquiry |
UMPS-17837M | Recombinant Mouse UMPS Protein | +Inquiry |
UMPS-4917R | Recombinant Rhesus Macaque UMPS Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UMPS-503HCL | Recombinant Human UMPS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UMPS Products
Required fields are marked with *
My Review for All UMPS Products
Required fields are marked with *