Recombinant Human Unc119b protein, GST-tagged
Cat.No. : | Unc119b-878M |
Product Overview : | Recombinant Human Unc119b protein(1-251 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | GST |
Protein Length : | 1-251 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | MSGSNPKAATAGSQAGPGGLVAGKEEKKKAGGGVLNRLKARRQGPPHTPDDGSGAAVTEQELLALDTIRPEHVLRLNRVTENYLCKPEDNVYSIDFTRFKIRDLETGTVLFEIAKPCISDQDQDAEEESVDVDISVGRFVRYQFTPAFLRLRTVGATVEFTVGDRPVTGFRMIERHYFRERLLKTFDFDFGFCIPSSRNTCEHIYEFPQLSEDVIRLMIENPYETRSDSFYFVDNKLVMHNKADYAYNGGQ |
Purity : | 80%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | UNC119B unc-119 homolog B (C. elegans) [ Homo sapiens ] |
Official Symbol | Unc119b |
Synonyms | UNC119B; unc-119 homolog B (C. elegans); unc119 (C.elegans) homolog B; MGC5139; POC7 centriolar protein homolog B (Chlamydomonas); POC7B; |
UniProt ID | A6NIH7 |
Gene ID | 114626 |
◆ Recombinant Proteins | ||
Unc119b-878M | Recombinant Human Unc119b protein, GST-tagged | +Inquiry |
UNC119B-17839M | Recombinant Mouse UNC119B Protein | +Inquiry |
UNC119B-3807Z | Recombinant Zebrafish UNC119B | +Inquiry |
UNC119B-5286H | Recombinant Human UNC119B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
UNC119B-5105R | Recombinant Rhesus monkey UNC119B Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Unc119b Products
Required fields are marked with *
My Review for All Unc119b Products
Required fields are marked with *