Recombinant Human UNC119B Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | UNC119B-5286H |
Product Overview : | UNC119B MS Standard C13 and N15-labeled recombinant protein (NP_001074002) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | UNC119B (Unc-119 Lipid Binding Chaperone B) is a Protein Coding gene. Diseases associated with UNC119B include Joubert Syndrome 22 and Retinitis Pigmentosa 2. Among its related pathways are Organelle biogenesis and maintenance and Cargo trafficking to the periciliary membrane. Gene Ontology (GO) annotations related to this gene include lipid binding. An important paralog of this gene is UNC119. |
Molecular Mass : | 28 kDa |
AA Sequence : | MSGSNPKAAAAASAAGPGGLVAGKEEKKKAGGGVLNRLKARRQAPHHAADDGVGAAVTEQELLALDTIRPEHVLRLSRVTENYLCKPEDNIYSIDFTRFKIRDLETGTVLFEIAKPCVSDQEEDEEEGGGDVDISAGRFVRYQFTPAFLRLRTVGATVEFTVGDKPVSNFRMIERHYFREHLLKNFDFDFGFCIPSSRNTCEHIYEFPQLSEDVIRLMIENPYETRSDSFYFVDNKLIMHNKADYAYNGGQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | UNC119B unc-119 lipid binding chaperone B [ Homo sapiens (human) ] |
Official Symbol | UNC119B |
Synonyms | UNC119B; unc-119 homolog B; unc119 (C.elegans) homolog B; MGC5139; POC7 centriolar protein homolog B (Chlamydomonas); POC7B; |
Gene ID | 84747 |
mRNA Refseq | NM_001080533 |
Protein Refseq | NP_001074002 |
UniProt ID | A6NIH7 |
◆ Recombinant Proteins | ||
UNC119B-3807Z | Recombinant Zebrafish UNC119B | +Inquiry |
UNC119B-9908M | Recombinant Mouse UNC119B Protein, His (Fc)-Avi-tagged | +Inquiry |
UNC119B-1398H | Recombinant Human Unc-119 Homolog B (C. elegans), His-tagged | +Inquiry |
UNC119B-5286H | Recombinant Human UNC119B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
UNC119B-17839M | Recombinant Mouse UNC119B Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UNC119B Products
Required fields are marked with *
My Review for All UNC119B Products
Required fields are marked with *