Recombinant Human UNC119B Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : UNC119B-5286H
Product Overview : UNC119B MS Standard C13 and N15-labeled recombinant protein (NP_001074002) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : UNC119B (Unc-119 Lipid Binding Chaperone B) is a Protein Coding gene. Diseases associated with UNC119B include Joubert Syndrome 22 and Retinitis Pigmentosa 2. Among its related pathways are Organelle biogenesis and maintenance and Cargo trafficking to the periciliary membrane. Gene Ontology (GO) annotations related to this gene include lipid binding. An important paralog of this gene is UNC119.
Molecular Mass : 28 kDa
AA Sequence : MSGSNPKAAAAASAAGPGGLVAGKEEKKKAGGGVLNRLKARRQAPHHAADDGVGAAVTEQELLALDTIRPEHVLRLSRVTENYLCKPEDNIYSIDFTRFKIRDLETGTVLFEIAKPCVSDQEEDEEEGGGDVDISAGRFVRYQFTPAFLRLRTVGATVEFTVGDKPVSNFRMIERHYFREHLLKNFDFDFGFCIPSSRNTCEHIYEFPQLSEDVIRLMIENPYETRSDSFYFVDNKLIMHNKADYAYNGGQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name UNC119B unc-119 lipid binding chaperone B [ Homo sapiens (human) ]
Official Symbol UNC119B
Synonyms UNC119B; unc-119 homolog B; unc119 (C.elegans) homolog B; MGC5139; POC7 centriolar protein homolog B (Chlamydomonas); POC7B;
Gene ID 84747
mRNA Refseq NM_001080533
Protein Refseq NP_001074002
UniProt ID A6NIH7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UNC119B Products

Required fields are marked with *

My Review for All UNC119B Products

Required fields are marked with *

0
cart-icon
0
compare icon