Recombinant Human UPF3A, His-tagged
Cat.No. : | UPF3A-31672TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 1-296 of Human UPF3A with N terminal His tag; 296 amino acids, 34kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-296 a.a. |
Description : | This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. The encoded protein is one of two functional homologs to yeast Upf3p. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. This protein binds to the mRNA and remains bound after nuclear export, acting as a nucleocytoplasmic shuttling protein. It forms with Y14 a complex that binds specifically 20 nt upstream of exon-exon junctions. This gene is located on the long arm of chromosome 13. Two splice variants encoding different isoforms have been found for this gene. |
Conjugation : | HIS |
Tissue specificity : | Isoform 1 is strongly expressed in testis, uterus, muscle, fetal brain and spinal cord. Isoform 2 is strongly expressed in fetal brain and spinal cord. |
Form : | Lyophilised:Reconstitute with 108 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MRSEKEGAGGLRAAVAARGPSGREKLSALEVQFHRDSQQQ EAETPPTSSSGCGGGAGKPREEKRTALSKVVIRRLPPG LTKEQLEEQLRPLPAHDYFEFFAADLSLYPHLYSRAYINF RNPDDILLFRDRFDGYIFLDSKDPEYKKFLETYCVEEE KTSANPETLLGEMEAKTRELIARRTTPLLEYIKNRKLE KQRIREEKREERRRRELEKKRLREEEKRRRREEERCKKKE TDKQKKIAEKEVRIKLLKKPEKGEEPTTEKPKERGEEI DTGGGKQESCAPGAVVKARPMEGS |
Sequence Similarities : | Belongs to the RENT3 family. |
Gene Name | UPF3A UPF3 regulator of nonsense transcripts homolog A (yeast) [ Homo sapiens ] |
Official Symbol | UPF3A |
Synonyms | UPF3A; UPF3 regulator of nonsense transcripts homolog A (yeast); regulator of nonsense transcripts 3A; HUPF3A; RENT3A; UPF3; |
Gene ID | 65110 |
mRNA Refseq | NM_023011 |
Protein Refseq | NP_075387 |
MIM | 605530 |
Uniprot ID | Q9H1J1 |
Chromosome Location | 13q34 |
Pathway | Exon junction complex (EJC), organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of RNA, organism-specific biosystem; Metabolism of mRNA, organism-specific biosystem; Nonsense Mediated Decay Enhanced by the Exon Junction Complex, organism-specific biosystem; |
Function | RNA binding; nucleocytoplasmic transporter activity; nucleotide binding; protein binding; |
◆ Recombinant Proteins | ||
UPF3A-7973Z | Recombinant Zebrafish UPF3A | +Inquiry |
UPF3A-31672TH | Recombinant Human UPF3A, His-tagged | +Inquiry |
Upf3a-6845M | Recombinant Mouse Upf3a Protein, Myc/DDK-tagged | +Inquiry |
UPF3A-6102H | Recombinant Human UPF3A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
UPF3A-1889HCL | Recombinant Human UPF3A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UPF3A Products
Required fields are marked with *
My Review for All UPF3A Products
Required fields are marked with *
0
Inquiry Basket