Recombinant Human UPF3A, His-tagged

Cat.No. : UPF3A-31672TH
Product Overview : Recombinant fragment, corresponding to amino acids 1-296 of Human UPF3A with N terminal His tag; 296 amino acids, 34kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-296 a.a.
Description : This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. The encoded protein is one of two functional homologs to yeast Upf3p. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. This protein binds to the mRNA and remains bound after nuclear export, acting as a nucleocytoplasmic shuttling protein. It forms with Y14 a complex that binds specifically 20 nt upstream of exon-exon junctions. This gene is located on the long arm of chromosome 13. Two splice variants encoding different isoforms have been found for this gene.
Conjugation : HIS
Tissue specificity : Isoform 1 is strongly expressed in testis, uterus, muscle, fetal brain and spinal cord. Isoform 2 is strongly expressed in fetal brain and spinal cord.
Form : Lyophilised:Reconstitute with 108 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MRSEKEGAGGLRAAVAARGPSGREKLSALEVQFHRDSQQQ EAETPPTSSSGCGGGAGKPREEKRTALSKVVIRRLPPG LTKEQLEEQLRPLPAHDYFEFFAADLSLYPHLYSRAYINF RNPDDILLFRDRFDGYIFLDSKDPEYKKFLETYCVEEE KTSANPETLLGEMEAKTRELIARRTTPLLEYIKNRKLE KQRIREEKREERRRRELEKKRLREEEKRRRREEERCKKKE TDKQKKIAEKEVRIKLLKKPEKGEEPTTEKPKERGEEI DTGGGKQESCAPGAVVKARPMEGS
Sequence Similarities : Belongs to the RENT3 family.
Gene Name UPF3A UPF3 regulator of nonsense transcripts homolog A (yeast) [ Homo sapiens ]
Official Symbol UPF3A
Synonyms UPF3A; UPF3 regulator of nonsense transcripts homolog A (yeast); regulator of nonsense transcripts 3A; HUPF3A; RENT3A; UPF3;
Gene ID 65110
mRNA Refseq NM_023011
Protein Refseq NP_075387
MIM 605530
Uniprot ID Q9H1J1
Chromosome Location 13q34
Pathway Exon junction complex (EJC), organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of RNA, organism-specific biosystem; Metabolism of mRNA, organism-specific biosystem; Nonsense Mediated Decay Enhanced by the Exon Junction Complex, organism-specific biosystem;
Function RNA binding; nucleocytoplasmic transporter activity; nucleotide binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UPF3A Products

Required fields are marked with *

My Review for All UPF3A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon