| Species : |
Human |
| Source : |
E.coli |
| Tag : |
His |
| Protein Length : |
1-296 a.a. |
| Description : |
This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. The encoded protein is one of two functional homologs to yeast Upf3p. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. This protein binds to the mRNA and remains bound after nuclear export, acting as a nucleocytoplasmic shuttling protein. It forms with Y14 a complex that binds specifically 20 nt upstream of exon-exon junctions. This gene is located on the long arm of chromosome 13. Two splice variants encoding different isoforms have been found for this gene. |
| Conjugation : |
HIS |
| Tissue specificity : |
Isoform 1 is strongly expressed in testis, uterus, muscle, fetal brain and spinal cord. Isoform 2 is strongly expressed in fetal brain and spinal cord. |
| Form : |
Lyophilised:Reconstitute with 108 μl aqua dest. |
| Storage buffer : |
Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : |
Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : |
MRSEKEGAGGLRAAVAARGPSGREKLSALEVQFHRDSQQQ EAETPPTSSSGCGGGAGKPREEKRTALSKVVIRRLPPG LTKEQLEEQLRPLPAHDYFEFFAADLSLYPHLYSRAYINF RNPDDILLFRDRFDGYIFLDSKDPEYKKFLETYCVEEE KTSANPETLLGEMEAKTRELIARRTTPLLEYIKNRKLE KQRIREEKREERRRRELEKKRLREEEKRRRREEERCKKKE TDKQKKIAEKEVRIKLLKKPEKGEEPTTEKPKERGEEI DTGGGKQESCAPGAVVKARPMEGS |
| Sequence Similarities : |
Belongs to the RENT3 family. |