Recombinant Human UPK1B protein, His-tagged
Cat.No. : | UPK1B-3838H |
Product Overview : | Recombinant Human UPK1B protein(108-229 aa), fused to His tag, was expressed in E. coli. |
Availability | August 27, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 108-229 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | TAATQRDFFTPNLFLKQMLERYQNNSPPNNDDQWKNNGVTKTWDRLMLQDNCCGVNGPSDWQKYTSAFRTENNDADYPWPRQCCVMNNLKEPLNLEACKLGVPGFYHNQGCYELISGPMNRH |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | UPK1B uroplakin 1B [ Homo sapiens ] |
Official Symbol | UPK1B |
Synonyms | UPK1B; uroplakin 1B; UPK1; uroplakin-1b; TSPAN20; UP1b; tspan-20; tetraspan; uroplakin Ib; tetraspanin-20; UPIB; |
Gene ID | 7348 |
mRNA Refseq | NM_006952 |
Protein Refseq | NP_008883 |
MIM | 602380 |
UniProt ID | O75841 |
◆ Recombinant Proteins | ||
UPK1B-3838H | Recombinant Human UPK1B protein, His-tagged | +Inquiry |
RFL17827BF | Recombinant Full Length Bovine Uroplakin-1B(Upk1B) Protein, His-Tagged | +Inquiry |
UPK1B-6456R | Recombinant Rat UPK1B Protein | +Inquiry |
RFL30279HF | Recombinant Full Length Human Uroplakin-1B(Upk1B) Protein, His-Tagged | +Inquiry |
UPK1B-6112R | Recombinant Rat UPK1B Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UPK1B Products
Required fields are marked with *
My Review for All UPK1B Products
Required fields are marked with *