Recombinant Human UQCR10 Protein (1-63 aa), GST-tagged
| Cat.No. : | UQCR10-2152H |
| Product Overview : | Recombinant Human UQCR10 Protein (1-63 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Tags & Cell Markers. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-63 aa |
| Description : | This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This subunit interacts with cytochrome c1. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 34.2 kDa |
| AA Sequence : | AAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | UQCR10 ubiquinol-cytochrome c reductase, complex III subunit X [ Homo sapiens (human) ] |
| Official Symbol | UQCR10 |
| Synonyms | QCR9; UCRC; HSPC051; HSPC119; HSPC151; UCCR7.2; |
| Gene ID | 29796 |
| mRNA Refseq | NM_001003684 |
| Protein Refseq | NP_001003684 |
| UniProt ID | Q9UDW1 |
| ◆ Recombinant Proteins | ||
| UQCR10-2152H | Recombinant Human UQCR10 Protein (1-63 aa), GST-tagged | +Inquiry |
| UQCR10-5629C | Recombinant Chicken UQCR10 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| UQCR10-490HCL | Recombinant Human UQCR10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UQCR10 Products
Required fields are marked with *
My Review for All UQCR10 Products
Required fields are marked with *
