Recombinant Human UQCRH Protein, GST-tagged

• Cat.No.: UQCRH-145H
• Product Overview: Recombinant Human UQCRH fused with GST tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Description: This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This protein may mediate formation of the complex between cytochromes c and c1.
• Form: Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4.
• Molecular Mass: 37.5kD
• AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSPEFHMGLEDEQKMLTESGDPEEEEEEEEE
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: UQCRH ubiquinol-cytochrome c reductase hinge protein [ Homo sapiens ]
• Official Symbol: UQCRH
• Synonyms: UQCRH; ubiquinol-cytochrome c reductase hinge protein; cytochrome b-c1 complex subunit 6, mitochondrial; QCR6; ubiquinol cytochrome c reductase; complex III subunit VIII; UQCR8; complex III subunit 6; mitochondrial hinge protein; cytochrome c1 non-heme 11 kDa protein; ubiquinol-cytochrome c reductase complex 11 kDa protein; ubiquinol-cytochrome c reductase, complex III subunit VIII; MGC111572
• Gene ID: 7388
• mRNA Refseq: NM_006004
• Protein Refseq: NP_005995
• MIM: 613844
• UniProt ID: P07919