Recombinant Human UQCRH Protein, GST-tagged
Cat.No. : | UQCRH-145H |
Product Overview : | Recombinant Human UQCRH fused with GST tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Description : | This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This protein may mediate formation of the complex between cytochromes c and c1. |
Form : | Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4. |
Molecular Mass : | 37.5kD |
AA Sequence : | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSPEFHMGLEDEQKMLTESGDPEEEEEEEEE |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | UQCRH ubiquinol-cytochrome c reductase hinge protein [ Homo sapiens ] |
Official Symbol | UQCRH |
Synonyms | UQCRH; ubiquinol-cytochrome c reductase hinge protein; cytochrome b-c1 complex subunit 6, mitochondrial; QCR6; ubiquinol cytochrome c reductase; complex III subunit VIII; UQCR8; complex III subunit 6; mitochondrial hinge protein; cytochrome c1 non-heme 11 kDa protein; ubiquinol-cytochrome c reductase complex 11 kDa protein; ubiquinol-cytochrome c reductase, complex III subunit VIII; MGC111572; |
Gene ID | 7388 |
mRNA Refseq | NM_006004 |
Protein Refseq | NP_005995 |
MIM | 613844 |
UniProt ID | P07919 |
◆ Recombinant Proteins | ||
Uqcrh-6853M | Recombinant Mouse Uqcrh Protein, Myc/DDK-tagged | +Inquiry |
UQCRH-4927R | Recombinant Rhesus Macaque UQCRH Protein, His (Fc)-Avi-tagged | +Inquiry |
UQCRH-6460R | Recombinant Rat UQCRH Protein | +Inquiry |
UQCRH-2457H | Recombinant human UQCRH, His-tagged | +Inquiry |
UQCRH-5050C | Recombinant Chicken UQCRH | +Inquiry |
◆ Cell & Tissue Lysates | ||
UQCRH-486HCL | Recombinant Human UQCRH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UQCRH Products
Required fields are marked with *
My Review for All UQCRH Products
Required fields are marked with *