Recombinant Human UQCRHL Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | UQCRHL-3552H |
Product Overview : | UQCRHL MS Standard C13 and N15-labeled recombinant protein (NP_001083060) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene has characteristics of a pseudogene derived from the UQCRH gene. However, there is still an open reading frame that could produce a protein of the same or nearly the same size as that of the UQCRH gene, so this gene is being called protein-coding for now. |
Molecular Mass : | 10.6 kDa |
AA Sequence : | MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELYDEHVSSRSHTEEDCTEELFDFLHAKDHCVAHKLFNNLKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | UQCRHL ubiquinol-cytochrome c reductase hinge protein like [ Homo sapiens (human) ] |
Official Symbol | UQCRHL |
Synonyms | UQCRHL; ubiquinol-cytochrome c reductase hinge protein like; cytochrome b-c1 complex subunit 6-like, mitochondrial; hCG25371 |
Gene ID | 440567 |
mRNA Refseq | NM_001089591 |
Protein Refseq | NP_001083060 |
UniProt ID | A0A096LP55 |
◆ Recombinant Proteins | ||
UQCRHL-3552H | Recombinant Human UQCRHL Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
UQCRHL-627H | Recombinant Human UQCRHL Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UQCRHL Products
Required fields are marked with *
My Review for All UQCRHL Products
Required fields are marked with *