Recombinant Human UQCRHL Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: UQCRHL-3552H
• Product Overview: UQCRHL MS Standard C13 and N15-labeled recombinant protein (NP_001083060) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene has characteristics of a pseudogene derived from the UQCRH gene. However, there is still an open reading frame that could produce a protein of the same or nearly the same size as that of the UQCRH gene, so this gene is being called protein-coding for now.
• Molecular Mass: 10.6 kDa
• AA Sequence: MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELYDEHVSSRSHTEEDCTEELFDFLHAKDHCVAHKLFNNLKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: UQCRHL ubiquinol-cytochrome c reductase hinge protein like [ Homo sapiens (human) ]
• Official Symbol: UQCRHL
• Synonyms: UQCRHL; ubiquinol-cytochrome c reductase hinge protein like; cytochrome b-c1 complex subunit 6-like, mitochondrial; hCG25371
• Gene ID: 440567
• mRNA Refseq: NM_001089591
• Protein Refseq: NP_001083060
• UniProt ID: A0A096LP55