Recombinant Human UQCRHL Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : UQCRHL-3552H
Product Overview : UQCRHL MS Standard C13 and N15-labeled recombinant protein (NP_001083060) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene has characteristics of a pseudogene derived from the UQCRH gene. However, there is still an open reading frame that could produce a protein of the same or nearly the same size as that of the UQCRH gene, so this gene is being called protein-coding for now.
Molecular Mass : 10.6 kDa
AA Sequence : MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELYDEHVSSRSHTEEDCTEELFDFLHAKDHCVAHKLFNNLKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name UQCRHL ubiquinol-cytochrome c reductase hinge protein like [ Homo sapiens (human) ]
Official Symbol UQCRHL
Synonyms UQCRHL; ubiquinol-cytochrome c reductase hinge protein like; cytochrome b-c1 complex subunit 6-like, mitochondrial; hCG25371
Gene ID 440567
mRNA Refseq NM_001089591
Protein Refseq NP_001083060
UniProt ID A0A096LP55

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UQCRHL Products

Required fields are marked with *

My Review for All UQCRHL Products

Required fields are marked with *

0
cart-icon