Recombinant Human USHBP1 protein, His-tagged
Cat.No. : | USHBP1-3612H |
Product Overview : | Recombinant Human USHBP1 protein(354-703 aa), fused with N-terminal His tag, was expressed in E.coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 354-703 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | EAYRVLLALREADSGAGDEAPMSDLQAAEKEAWRLLAQEEAAMDAGAQQNPQPSPEGSSVDKPTPQEVAFQLRSYVQRLQERRSLMKILSEPGPTLAPMPTVPRAEAMVQAILGTQAGPALPRLEKTQIQQDLVAAREALADLMLRLQLVRREKRGLELREAALRALGPAHVLLLEQLRWERAELQAGGANSSGGHSSGGGSSGDEEEWYQGLPAVPGGTSGIDGGQVGRAWDPEKLAQELAASLTRTLDLQEQLQSLRRELEQVAQKGRARRSQSAELNRDLCKAHSALVLAFRGAHRKQEEQRRKLEQQMALMEAQQAEEVAVLEATARALGKPRPPLPPPQLGDTFL |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
◆ Recombinant Proteins | ||
USHBP1-680H | Recombinant Human USHBP1 Protein, MYC/DDK-tagged | +Inquiry |
USHBP1-9943M | Recombinant Mouse USHBP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
USHBP1-17895M | Recombinant Mouse USHBP1 Protein | +Inquiry |
Ushbp1-6861M | Recombinant Mouse Ushbp1 Protein, Myc/DDK-tagged | +Inquiry |
USHBP1-6121R | Recombinant Rat USHBP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
USHBP1-727HCL | Recombinant Human USHBP1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All USHBP1 Products
Required fields are marked with *
My Review for All USHBP1 Products
Required fields are marked with *
0
Inquiry Basket