Recombinant Human USP12 protein, His-tagged

• Cat.No.: USP12-3814H
• Product Overview: Recombinant Human USP12 protein, fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: RPFREKVLAYKSQPRKKESLLTCLADLFHSIATQKKKVGVIPPKKFITRLRKENELFDNYMQQDAHEFLNYLLNTIADILQEERKQEKQNGRLPNGNIDNENNNSTPDPTWVHEIFQGTLTNETRCLTCETISSKDEDFLDLSVDVEQNTSITHCLRGFSNTETLCSEYKYYCEECRSKQEAHKRMKVKKL
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: USP12 ubiquitin specific peptidase 12 [ Homo sapiens ]
• Official Symbol: USP12
• Synonyms: USP12; ubiquitin specific peptidase 12; ubiquitin specific protease 12 , ubiquitin specific protease 12 like 1 , USP12L1; ubiquitin carboxyl-terminal hydrolase 12; ubiquitin thioesterase 12; deubiquitinating enzyme 12; ubiquitin thiolesterase 12; ubiquitin-hydrolyzing enzyme 1; ubiquitin specific protease 12 like 1; ubiquitin-specific-processing protease 12; UBH1; USP12L1
• Gene ID: 219333
• mRNA Refseq: NM_182488
• Protein Refseq: NP_872294
• UniProt ID: O75317