Recombinant Human USP15 protein, GST-tagged
Cat.No. : | USP15-301633H |
Product Overview : | Recombinant Human USP15 (1-235 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Cys235 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MAEGGAADLDTQRSDIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQNVYPGPIDNSGLLKDGDAQSLKEHLIDELDYILLPTEGWNKLVSWYTLMEGQEPIARKVVEQGMFVKHCKVEVYLTELKLCENGNMNNVVTRRFSKADTIDTIEKEIRKIFSIPDEKETRLWNKYMSNTFEPLNKPDSTIQDAGLYQGQVLVIEQKNEDGTWPRGPSTPKKPLEQSC |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | USP15 ubiquitin specific peptidase 15 [ Homo sapiens ] |
Official Symbol | USP15 |
Synonyms | USP15; ubiquitin specific peptidase 15; ubiquitin specific protease 15; ubiquitin carboxyl-terminal hydrolase 15; KIAA0529; UNPH4; ubiquitin thioesterase 15; deubiquitinating enzyme 15; ubiquitin thiolesterase 15; ubiquitin-specific-processing protease 15; UNPH-2; FLJ55073; MGC74854; MGC131982; MGC149838; |
Gene ID | 9958 |
mRNA Refseq | NM_001252078 |
Protein Refseq | NP_001239007 |
MIM | 604731 |
UniProt ID | Q9Y4E8 |
◆ Recombinant Proteins | ||
USP15-15881H | Recombinant Human USP15, His-tagged | +Inquiry |
USP15-358H | Active Recombinant Human USP15 Protein, His-tagged | +Inquiry |
USP15-17904M | Recombinant Mouse USP15 Protein | +Inquiry |
USP15-0555H | Recombinant Human USP15 Protein (A2-N981), Tag Free | +Inquiry |
USP15-361H | Recombinant Human USP15 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All USP15 Products
Required fields are marked with *
My Review for All USP15 Products
Required fields are marked with *
0
Inquiry Basket