Recombinant Human USP24 protein, GST-tagged

Cat.No. : USP24-252H
Product Overview : Recombinant Human USP24(1 a.a. - 309 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-309 a.a.
Description : Modification of cellular proteins by ubiquitin is an essential regulatory mechanism controlled by the coordinated action of multiple ubiquitin-conjugating and deubiquitinating enzymes. USP24 belongs to a large family of cysteine proteases that function as deubiquitinating enzymes (Quesada et al., 2004 [PubMed 14715245]).
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 59.73 kDa
AA Sequence : MISFLLGASRQNNQIRRWSSAQAREFGNLHNTVALLVLHSDVSSQRNVAPGIFKQRPPISIAPSSPLLPLHEEVE ALLFMSEGKPYLLEVMFALRELTGSLLALIEMVVYCCFCNEHFSFTMLHFIKNQLETAPPHELKNTFQLLHEILV IEDPIQVERVKFVFETENGLLALMHHSNHVDSSRCYQCVKFLVTLAQKCPAAKEYFKENSHHWSWAVQWLQKKMS EHYWTPQSNVSNETSTGKTFQRTISAQDTLAYATALLNEKEQSGSSNGSESSPANENGDRHLQQGSESPMMIGEL RSDLDDVDP
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name USP24 ubiquitin specific peptidase 24 [ Homo sapiens ]
Official Symbol USP24
Synonyms USP24; ubiquitin specific peptidase 24; ubiquitin specific protease 24; ubiquitin carboxyl-terminal hydrolase 24; KIAA1057; ubiquitin thioesterase 24; deubiquitinating enzyme 24; ubiquitin thiolesterase 24; ubiquitin-specific processing protease 24; ubiquitin-specific-processing protease 24; FLJ31309;
Gene ID 23358
mRNA Refseq NM_015306
Protein Refseq NP_056121
MIM 610569
UniProt ID Q9UPU5
Chromosome Location 1p32.3
Function binding; cysteine-type peptidase activity; peptidase activity; ubiquitin thiolesterase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All USP24 Products

Required fields are marked with *

My Review for All USP24 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon