"USP24" Related Products

Expand
Expand

Recombinant Human USP24 protein, GST-tagged

Cat.No.: USP24-252H
Product Overview: Recombinant Human USP24(1 a.a. - 309 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description: Modification of cellular proteins by ubiquitin is an essential regulatory mechanism controlled by the coordinated action of multiple ubiquitin-conjugating and deubiquitinating enzymes. USP24 belongs to a large family of cysteine proteases that function as deubiquitinating enzymes (Quesada et al., 2004 [PubMed 14715245]).
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 59.73 kDa
AA Sequence: MISFLLGASRQNNQIRRWSSAQAREFGNLHNTVALLVLHSDVSSQRNVAPGIFKQRPPISIAPSSPLLPLHEEVE ALLFMSEGKPYLLEVMFALRELTGSLLALIEMVVYCCFCNEHFSFTMLHFIKNQLETAPPHELKNTFQLLHEILV IEDPIQVERVKFVFETENGLLALMHHSNHVDSSRCYQCVKFLVTLAQKCPAAKEYFKENSHHWSWAVQWLQKKMS EHYWTPQSNVSNETSTGKTFQRTISAQDTLAYATALLNEKEQSGSSNGSESSPANENGDRHLQQGSESPMMIGEL RSDLDDVDP
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: USP24 ubiquitin specific peptidase 24 [ Homo sapiens ]
Official Symbol: USP24
Synonyms: USP24; ubiquitin specific peptidase 24; ubiquitin specific protease 24; ubiquitin carboxyl-terminal hydrolase 24; KIAA1057; ubiquitin thioesterase 24; deubiquitinating enzyme 24; ubiquitin thiolesterase 24; ubiquitin-specific processing protease 24; ubiquitin-specific-processing protease 24; FLJ31309;
Gene ID: 23358
mRNA Refseq: NM_015306
Protein Refseq: NP_056121
MIM: 610569
UniProt ID: Q9UPU5
Chromosome Location: 1p32.3
Function: binding; cysteine-type peptidase activity; peptidase activity; ubiquitin thiolesterase activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.