Recombinant Human USP28 protein, His/Myc-tagged
Cat.No. : | USP28-153H |
Product Overview : | Recombinant Human USP28(1-583 aa) fused with His tag at N-terminal and Myc tag at C-terminalwas expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1-583 aa |
Description : | The protein encoded by this gene is a deubiquitinase involved in the DNA damage pathway and DNA damage-induced apoptosis. Overexpression of this gene is seen in several cancers. |
Form : | Tris-based buffer,50% glycerol |
AA Sequence : | MTAELQQDDAAGAADGHGSSCQMLLNQLREITGIQDPSFLHEALKASNGDITQAVSLLTD ERVKEPSQDTVATEPSEVEGSAANKEVLAKVIDLTHDNKDDLQAAIALSLLESPKIQADG RDLNRMHEATSAETKRSKRKRCEVWGENPNPNDWRRVDGWPVGLKNVGNTCWFSAVIQSL FQLPEFRRLVLSYSLPQNVLENCRSHTEKRNIMFMQELQYLFALMMGSNRKFVDPSAALD LLKGAFRSSEEQQQDVSEFTHKLLDWLEDAFQLAVNVNSPRNKSENPMVQLFYGTFLTEG VREGKPFCNNETFGQYPLQVNGYRNLDECLEGAMVEGDVELLPSDHSVKYGQERWFTKLP PVLTFELSRFEFNQSLGQPEKIHNKLEFPQIIYMDRYMYRSKELIRNKRECIRKLKEEIK ILQQKLERYVKYGSGPARFPLPDMLKYVIEFASTKPASESCPPESDTHMTLPLSSVHCSV SDQTSKESTSTESSSQDVESTFSSPEDSLPKSKPLTSSRSSMEMPSQPAPRTVTDEEINF VKTCLQRWRSEIEQDIQDLKTCIASTTQTIEQMYCDPLLRQVE |
Purity : | >90% ( SDS-PAGE ) |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | USP28 ubiquitin specific peptidase 28 [ Homo sapiens ] |
Official Symbol | USP28 |
Synonyms | USP28; ubiquitin specific peptidase 28; ubiquitin specific protease 28; ubiquitin carboxyl-terminal hydrolase 28; KIAA1515; ubiquitin thioesterase 28; deubiquitinating enzyme 28; ubiquitin thiolesterase 28; ubiquitin-specific-processing protease 28; |
Gene ID | 57646 |
mRNA Refseq | NM_020886 |
Protein Refseq | NP_065937 |
MIM | 610748 |
UniProt ID | Q96RU2 |
Chromosome Location | 11q23 |
Function | cysteine-type peptidase activity; peptidase activity; protein binding; ubiquitin thiolesterase activity; ubiquitin thiolesterase activity; ubiquitin-specific protease activity; |
◆ Recombinant Proteins | ||
USP28-152H | Recombinant Human USP28, His-tagged | +Inquiry |
USP28-0346H | Recombinant Human USP28 Protein (T2-K1077), His tagged | +Inquiry |
USP28-0345H | Recombinant Human USP28 Protein (T2-K1077), Tag Free | +Inquiry |
USP28-188H | Active Recombinant Human USP28, GST-tagged | +Inquiry |
USP28-6131R | Recombinant Rat USP28 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
USP28-1895HCL | Recombinant Human USP28 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All USP28 Products
Required fields are marked with *
My Review for All USP28 Products
Required fields are marked with *