Recombinant Human USP29 protein, GST-tagged

• Cat.No.: USP29-301296H
• Product Overview: Recombinant Human USP29 (1-285 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Met1-Gln285
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: MISLKVCGFIQIWSQKTGMTKLKEALIETVQRQKEIKLVVTFKSGKFIRIFQLSNNIRSVVLRHCKKRQSHLRLTLKNNVFLFIDKLSYRDAKQLNMFLDIIHQNKSQQPMKSDDDWSVFESRNMLKEIDKTSFYSICNKPSYQKMPLFMSKSPTHVKKGILENQGGKGQNTLSSDVQTNEDILKEDNPVPNKKYKTDSLKYIQSNRKNPSSLEDLEKDRDLKLGPSFNTNCNGNPNLDETVLATQTLNAKNGLTSPLEPEHSQGDPRCNKAQVPLDSHSQQLQQ
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: USP29 ubiquitin specific peptidase 29 [ Homo sapiens ]
• Official Symbol: USP29
• Synonyms: USP29; ubiquitin specific peptidase 29; ubiquitin specific protease 29; ubiquitin carboxyl-terminal hydrolase 29; ubiquitin thioesterase 29; deubiquitinating enzyme 29; ubiquitin thiolesterase 29; ubiquitin-specific processing protease; ubiquitin-specific-processing protease 29; HOM-TES-84/86; MGC163266; MGC163270
• Gene ID: 57663
• mRNA Refseq: NM_020903
• Protein Refseq: NP_065954
• MIM: 609546
• UniProt ID: Q9HBJ7