Recombinant Human USP29 protein, GST-tagged
Cat.No. : | USP29-301296H |
Product Overview : | Recombinant Human USP29 (1-285 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Gln285 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MISLKVCGFIQIWSQKTGMTKLKEALIETVQRQKEIKLVVTFKSGKFIRIFQLSNNIRSVVLRHCKKRQSHLRLTLKNNVFLFIDKLSYRDAKQLNMFLDIIHQNKSQQPMKSDDDWSVFESRNMLKEIDKTSFYSICNKPSYQKMPLFMSKSPTHVKKGILENQGGKGQNTLSSDVQTNEDILKEDNPVPNKKYKTDSLKYIQSNRKNPSSLEDLEKDRDLKLGPSFNTNCNGNPNLDETVLATQTLNAKNGLTSPLEPEHSQGDPRCNKAQVPLDSHSQQLQQ |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | USP29 ubiquitin specific peptidase 29 [ Homo sapiens ] |
Official Symbol | USP29 |
Synonyms | USP29; ubiquitin specific peptidase 29; ubiquitin specific protease 29; ubiquitin carboxyl-terminal hydrolase 29; ubiquitin thioesterase 29; deubiquitinating enzyme 29; ubiquitin thiolesterase 29; ubiquitin-specific processing protease; ubiquitin-specific-processing protease 29; HOM-TES-84/86; MGC163266; MGC163270; |
Gene ID | 57663 |
mRNA Refseq | NM_020903 |
Protein Refseq | NP_065954 |
MIM | 609546 |
UniProt ID | Q9HBJ7 |
◆ Recombinant Proteins | ||
USP29-0348H | Recombinant Human USP29 Protein (I2-A922), Flag tagged | +Inquiry |
USP29-0347H | Recombinant Human USP29 Protein (I2-A922), Tag Free | +Inquiry |
USP29-301296H | Recombinant Human USP29 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All USP29 Products
Required fields are marked with *
My Review for All USP29 Products
Required fields are marked with *
0
Inquiry Basket