Recombinant Human USP33 protein, GST-tagged
Cat.No. : | USP33-3015H |
Product Overview : | Recombinant Human USP33 (290-472 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Glu290-Arg472 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | QVMEVEEDPQTITTEETMEEDKSQSDVDFQSCESCSNSDRAENENGSRCFSEDNNETTMLIQDDENNSEMSKDWQKEKMCNKINKVNSEGEFDKDRDSISETVDLNNQETVKVQIHSRASEYITDVHSNDLSTPQILPSNEGVNPRLSASPPKSGNLWPGLAPPHKKAQSASPKRKKQHKKYR |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | USP33 ubiquitin specific peptidase 33 [ Homo sapiens ] |
Official Symbol | USP33 |
Synonyms | USP33; ubiquitin specific peptidase 33; ubiquitin specific protease 33; ubiquitin carboxyl-terminal hydrolase 33; KIAA1097; VDU1; hVDU1; ubiquitin thioesterase 33; deubiquitinating enzyme 33; ubiquitin thiolesterase 33; VHL-interacting deubiquitinating enzyme 1; ubiquitin-specific-processing protease 33; pVHL-interacting deubiquitinating enzyme 1; MGC16868; |
Gene ID | 23032 |
mRNA Refseq | NM_015017 |
Protein Refseq | NP_055832 |
MIM | 615146 |
UniProt ID | Q8TEY7 |
◆ Recombinant Proteins | ||
USP33-154H | Recombinant Human USP3, His-SUMO-tagged | +Inquiry |
Usp33-6875M | Recombinant Mouse Usp33 Protein, Myc/DDK-tagged | +Inquiry |
USP33-3627H | Recombinant Human USP33, GST-tagged | +Inquiry |
USP33-3015H | Recombinant Human USP33 protein, GST-tagged | +Inquiry |
USP33-0369H | Recombinant Human USP33 Protein (T2-L942), Tag Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
USP33-461HCL | Recombinant Human USP33 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All USP33 Products
Required fields are marked with *
My Review for All USP33 Products
Required fields are marked with *
0
Inquiry Basket