Recombinant Human USP8 protein, His-tagged
| Cat.No. : | USP8-3938H |
| Product Overview : | Recombinant Human USP8 protein(15-253 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 16, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 15-253 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | SSLKDLNKKTEVKPEKISTKSYVHSALKIFKTAEECRLDRDEERAYVLYMKYVTVYNLIKKRPDFKQQQDYFHSILGPGNIKKAVEEAERLSESLKLRYEEAEVRKKLEEKDRQEEAQRLQQKRQETGREDGGTLAKGSLENVLDSKDKTQKSNGEKNEKCETKEKGAITAKELYTMMTDKNISLIIMDARRMQDYQDSCILHSLSVPEEAISPGVTASWIEAHLPDDSKDTWKKRGNV |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | USP8 ubiquitin specific peptidase 8 [ Homo sapiens ] |
| Official Symbol | USP8 |
| Synonyms | USP8; ubiquitin specific peptidase 8; ubiquitin specific protease 8; ubiquitin carboxyl-terminal hydrolase 8; HumORF8; KIAA0055; UBPY; hUBPy; ubiquitin isopeptidase Y; ubiquitin thioesterase 8; deubiquitinating enzyme 8; ubiquitin thiolesterase 8; ubiquitin-specific-processing protease 8; FLJ34456; MGC129718; |
| Gene ID | 9101 |
| mRNA Refseq | NM_001128610 |
| Protein Refseq | NP_001122082 |
| MIM | 603158 |
| UniProt ID | P40818 |
| ◆ Recombinant Proteins | ||
| USP8-86H | Active Recombinant Human USP8, FLAG-tagged | +Inquiry |
| Usp8-6883M | Recombinant Mouse Usp8 Protein, Myc/DDK-tagged | +Inquiry |
| USP8-162H | Recombinant Human USP8, His-tagged | +Inquiry |
| USP8-5132R | Recombinant Rhesus monkey USP8 Protein, His-tagged | +Inquiry |
| USP8-127H | Active Recombinant Human USP8 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| USP8-451HCL | Recombinant Human USP8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All USP8 Products
Required fields are marked with *
My Review for All USP8 Products
Required fields are marked with *
