Recombinant Human UTRN protein, His-tagged
| Cat.No. : | UTRN-3304H |
| Product Overview : | Recombinant Human UTRN protein, fused to His tag, was expressed in E. coli. |
| Availability | July 29, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MQTTEIKEYMKMQDTSEMKKKLKALEKEQRERIPRADELNQTGQILVEQMGKEGLPTEEIKNVLEKVSSEWKNVSQHLEDLERKIQLQEDINAYFKQLDELEKVIKTKEEWVKHTSISESSRQSLPSLKDSCQRELTNLLGLHPKIEMARASCSALMSQPSAPDFVQRGFDSFLGRYQAVQEAVEDRQQHLENELKGQPGHAYLETLKTLKDVLNDSENKAQV |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | UTRN utrophin [ Homo sapiens ] |
| Official Symbol | UTRN |
| Synonyms | UTRN; utrophin; DMDL, utrophin (homologous to dystrophin); DRP; DRP1; DRP-1; dystrophin-related protein 1; DMDL; FLJ23678; |
| Gene ID | 7402 |
| mRNA Refseq | NM_007124 |
| Protein Refseq | NP_009055 |
| MIM | 128240 |
| UniProt ID | P46939 |
| ◆ Recombinant Proteins | ||
| UTRN-3304H | Recombinant Human UTRN protein, His-tagged | +Inquiry |
| UTRN-378H | Recombinant Human UTRN Protein, His-tagged | +Inquiry |
| UTRN-301558H | Recombinant Human UTRN protein, GST-tagged | +Inquiry |
| Utrn-542M | Recombinant Mouse Utrn Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UTRN Products
Required fields are marked with *
My Review for All UTRN Products
Required fields are marked with *



