Recombinant Human UTRN protein, His-tagged
Cat.No. : | UTRN-3304H |
Product Overview : | Recombinant Human UTRN protein, fused to His tag, was expressed in E. coli. |
Availability | August 23, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MQTTEIKEYMKMQDTSEMKKKLKALEKEQRERIPRADELNQTGQILVEQMGKEGLPTEEIKNVLEKVSSEWKNVSQHLEDLERKIQLQEDINAYFKQLDELEKVIKTKEEWVKHTSISESSRQSLPSLKDSCQRELTNLLGLHPKIEMARASCSALMSQPSAPDFVQRGFDSFLGRYQAVQEAVEDRQQHLENELKGQPGHAYLETLKTLKDVLNDSENKAQV |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | UTRN utrophin [ Homo sapiens ] |
Official Symbol | UTRN |
Synonyms | UTRN; utrophin; DMDL, utrophin (homologous to dystrophin); DRP; DRP1; DRP-1; dystrophin-related protein 1; DMDL; FLJ23678; |
Gene ID | 7402 |
mRNA Refseq | NM_007124 |
Protein Refseq | NP_009055 |
MIM | 128240 |
UniProt ID | P46939 |
◆ Recombinant Proteins | ||
UTRN-3304H | Recombinant Human UTRN protein, His-tagged | +Inquiry |
UTRN-301558H | Recombinant Human UTRN protein, GST-tagged | +Inquiry |
UTRN-378H | Recombinant Human UTRN Protein, His-tagged | +Inquiry |
Utrn-542M | Recombinant Mouse Utrn Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UTRN Products
Required fields are marked with *
My Review for All UTRN Products
Required fields are marked with *