Recombinant Human UXS1 protein, His-tagged
| Cat.No. : | UXS1-3638H | 
| Product Overview : | Recombinant Human UXS1 protein(Q8NBZ7)(Ile51-Ser420), fused with C-terminal His tag, was expressed in E. coli. | 
| Availability | October 30, 2025 | 
| Unit | |
| Price | |
| Qty | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | Ile51-Ser420 | 
| Tag : | C-His | 
| Form : | Phosphate buffered saline | 
| Molecular Mass : | 44 kDa | 
| Storage : | Store at -20°C to -80°C. | 
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. | 
| AA Sequence : | IESKIEEMVEPLREKIRDLEKSFTQKYPPVKFLSEKDRKRILITGGAGFVGSHLTDKLMMDGHEVTVVDNFFTGRKRNVEHWIGHENFELINHDVVEPLYIEVDQIYHLASPASPPNYMYNPIKTLKTNTIGTLNMLGLAKRVGARLLLASTSEVYGDPEVHPQSEDYWGHVNPIGPRACYDEGKRVAETMCYAYMKQEGVEVRVARIFNTFGPRMHMNDGRVVSNFILQALQGEPLTVYGSGSQTRAFQYVSDLVNGLVALMNSNVSSPVNLGNPEEHTILEFAQLIKNLVGSGSEIQFLSEAQDDPQKRKPDIKKAKLMLGWEPVVPLEEGLNKAIHYFRKELEYQANNQYIPKPKPARIKKGRTRHS | 
| Gene Name | UXS1 UDP-glucuronate decarboxylase 1 [ Homo sapiens ] | 
| Official Symbol | UXS1 | 
| Synonyms | UGD; SDR6E1 | 
| Gene ID | 80146 | 
| mRNA Refseq | NM_025076.4 | 
| Protein Refseq | NP_079352.2 | 
| MIM | 609749 | 
| UniProt ID | Q8NBZ7 | 
| ◆ Recombinant Proteins | ||
| UXS1-6143R | Recombinant Rat UXS1 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| UXS1-3638H | Recombinant Human UXS1 protein, His-tagged | +Inquiry | 
| UXS1-3640H | Recombinant Full Length Human UXS1 Protein, Flag tagged | +Inquiry | 
| UXS1-3639H | Recombinant Full Length Human UXS1 Protein, GST tagged | +Inquiry | 
| UXS1-9516Z | Recombinant Zebrafish UXS1 | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| UXS1-443HCL | Recombinant Human UXS1 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UXS1 Products
Required fields are marked with *
My Review for All UXS1 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            