Recombinant Human UXS1 protein, His-tagged
| Cat.No. : | UXS1-3638H |
| Product Overview : | Recombinant Human UXS1 protein(Q8NBZ7)(Ile51-Ser420), fused with C-terminal His tag, was expressed in E. coli. |
| Availability | November 21, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Ile51-Ser420 |
| Tag : | C-His |
| Form : | Phosphate buffered saline |
| Molecular Mass : | 44 kDa |
| Storage : | Store at -20°C to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | IESKIEEMVEPLREKIRDLEKSFTQKYPPVKFLSEKDRKRILITGGAGFVGSHLTDKLMMDGHEVTVVDNFFTGRKRNVEHWIGHENFELINHDVVEPLYIEVDQIYHLASPASPPNYMYNPIKTLKTNTIGTLNMLGLAKRVGARLLLASTSEVYGDPEVHPQSEDYWGHVNPIGPRACYDEGKRVAETMCYAYMKQEGVEVRVARIFNTFGPRMHMNDGRVVSNFILQALQGEPLTVYGSGSQTRAFQYVSDLVNGLVALMNSNVSSPVNLGNPEEHTILEFAQLIKNLVGSGSEIQFLSEAQDDPQKRKPDIKKAKLMLGWEPVVPLEEGLNKAIHYFRKELEYQANNQYIPKPKPARIKKGRTRHS |
| Gene Name | UXS1 UDP-glucuronate decarboxylase 1 [ Homo sapiens ] |
| Official Symbol | UXS1 |
| Synonyms | UGD; SDR6E1 |
| Gene ID | 80146 |
| mRNA Refseq | NM_025076.4 |
| Protein Refseq | NP_079352.2 |
| MIM | 609749 |
| UniProt ID | Q8NBZ7 |
| ◆ Recombinant Proteins | ||
| UXS1-6487R | Recombinant Rat UXS1 Protein | +Inquiry |
| UXS1-9985M | Recombinant Mouse UXS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| UXS1-3639H | Recombinant Full Length Human UXS1 Protein, GST tagged | +Inquiry |
| Uxs1-6888M | Recombinant Mouse Uxs1 Protein, Myc/DDK-tagged | +Inquiry |
| UXS1-3640H | Recombinant Full Length Human UXS1 Protein, Flag tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| UXS1-443HCL | Recombinant Human UXS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UXS1 Products
Required fields are marked with *
My Review for All UXS1 Products
Required fields are marked with *
