Recombinant Human UXS1 protein, His-tagged
Cat.No. : | UXS1-3638H |
Product Overview : | Recombinant Human UXS1 protein(Q8NBZ7)(Ile51-Ser420), fused with C-terminal His tag, was expressed in E. coli. |
Availability | October 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Ile51-Ser420 |
Tag : | C-His |
Form : | Phosphate buffered saline |
Molecular Mass : | 44 kDa |
Storage : | Store at -20°C to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | IESKIEEMVEPLREKIRDLEKSFTQKYPPVKFLSEKDRKRILITGGAGFVGSHLTDKLMMDGHEVTVVDNFFTGRKRNVEHWIGHENFELINHDVVEPLYIEVDQIYHLASPASPPNYMYNPIKTLKTNTIGTLNMLGLAKRVGARLLLASTSEVYGDPEVHPQSEDYWGHVNPIGPRACYDEGKRVAETMCYAYMKQEGVEVRVARIFNTFGPRMHMNDGRVVSNFILQALQGEPLTVYGSGSQTRAFQYVSDLVNGLVALMNSNVSSPVNLGNPEEHTILEFAQLIKNLVGSGSEIQFLSEAQDDPQKRKPDIKKAKLMLGWEPVVPLEEGLNKAIHYFRKELEYQANNQYIPKPKPARIKKGRTRHS |
Gene Name | UXS1 UDP-glucuronate decarboxylase 1 [ Homo sapiens ] |
Official Symbol | UXS1 |
Synonyms | UGD; SDR6E1 |
Gene ID | 80146 |
mRNA Refseq | NM_025076.4 |
Protein Refseq | NP_079352.2 |
MIM | 609749 |
UniProt ID | Q8NBZ7 |
◆ Recombinant Proteins | ||
UXS1-6143R | Recombinant Rat UXS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
UXS1-3638H | Recombinant Human UXS1 protein, His-tagged | +Inquiry |
UXS1-3640H | Recombinant Full Length Human UXS1 Protein, Flag tagged | +Inquiry |
UXS1-3639H | Recombinant Full Length Human UXS1 Protein, GST tagged | +Inquiry |
UXS1-9516Z | Recombinant Zebrafish UXS1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
UXS1-443HCL | Recombinant Human UXS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UXS1 Products
Required fields are marked with *
My Review for All UXS1 Products
Required fields are marked with *