Recombinant Human v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) Protein, His-tagged

Cat.No. : SRC-001H
Product Overview : Recombinant Human SRC Protein (1-79aa) with C-His-tag was expressed in E. coli.
Availability June 09, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-79aa
Description : This gene is highly similar to the v-src gene of Rous sarcoma virus. This proto-oncogene may play a role in the regulation of embryonic development and cell growth. The protein encoded by this gene is a tyrosine-protein kinase whose activity can be inhibited by phosphorylation by c-SRC kinase. Mutations in this gene could be involved in the malignant progression of colon cancer. Two transcript variants encoding the same protein have been found for this gene.
Tag : C-His
Molecular Mass : 9 kDa
AA Sequence : MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAHHHHHHHH
Endotoxin : < 1 EU/μg by LAL.
Purity : > 90 % by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 1 mg/mL by BCA
Storage Buffer : Sterile PBS, pH7.4
Gene Name SRC v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) [Homo sapiens (human)]
Official Symbol SRC
Synonyms SRC; v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian); SRC1, v src avian sarcoma (Schmidt Ruppin A 2) viral oncogene homolog; proto-oncogene tyrosine-protein kinase Src; ASV; c src; proto-oncogene c-Src; tyrosine kinase pp60c-src; tyrosine-protein kinase SRC-1; protooncogene SRC, Rous sarcoma; SRC1; c-SRC; p60-Src
Gene ID 6714
mRNA Refseq NM_005417
Protein Refseq NP_005408
MIM 190090
UniProt ID P12931

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SRC Products

Required fields are marked with *

My Review for All SRC Products

Required fields are marked with *

0

Inquiry Basket

cartIcon