Recombinant Human v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) Protein, His-tagged
| Cat.No. : | SRC-001H |
| Product Overview : | Recombinant Human SRC Protein (1-79aa) with C-His-tag was expressed in E. coli. |
| Availability | January 27, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-79aa |
| Description : | This gene is highly similar to the v-src gene of Rous sarcoma virus. This proto-oncogene may play a role in the regulation of embryonic development and cell growth. The protein encoded by this gene is a tyrosine-protein kinase whose activity can be inhibited by phosphorylation by c-SRC kinase. Mutations in this gene could be involved in the malignant progression of colon cancer. Two transcript variants encoding the same protein have been found for this gene. |
| Tag : | C-His |
| Molecular Mass : | 9 kDa |
| AA Sequence : | MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAHHHHHHHH |
| Endotoxin : | < 1 EU/μg by LAL. |
| Purity : | > 90 % by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 1 mg/mL by BCA |
| Storage Buffer : | Sterile PBS, pH7.4 |
| Gene Name | SRC v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) [Homo sapiens (human)] |
| Official Symbol | SRC |
| Synonyms | SRC; v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian); SRC1, v src avian sarcoma (Schmidt Ruppin A 2) viral oncogene homolog; proto-oncogene tyrosine-protein kinase Src; ASV; c src; proto-oncogene c-Src; tyrosine kinase pp60c-src; tyrosine-protein kinase SRC-1; protooncogene SRC, Rous sarcoma; SRC1; c-SRC; p60-Src |
| Gene ID | 6714 |
| mRNA Refseq | NM_005417 |
| Protein Refseq | NP_005408 |
| MIM | 190090 |
| UniProt ID | P12931 |
| ◆ Recombinant Proteins | ||
| SRC-6766HF | Active Recombinant Full Length Human SRC Protein, DDK-tagged, Biotinylated | +Inquiry |
| SRC-22H | Recombinant Human SRC protein, His-tagged | +Inquiry |
| SRC-192H | Recombinant Human SRC, SH3 Domain, GST-tagged | +Inquiry |
| SRC-1100H | Active Recombinant Human SRC protein, GST-tagged | +Inquiry |
| SRC-4460R | Recombinant Rhesus monkey SRC Protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| SRC-29697TH | Native Human SRC | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SRC-585MCL | Recombinant Mouse SRC cell lysate | +Inquiry |
| SRC-487HCL | Recombinant Human SRC cell lysate | +Inquiry |
| SRC-494HKCL | Human SRC Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SRC Products
Required fields are marked with *
My Review for All SRC Products
Required fields are marked with *
