Recombinant Human v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) Protein, His-tagged

• Cat.No.: SRC-001H
• Product Overview: Recombinant Human SRC Protein (1-79aa) with C-His-tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-79aa
• Description: This gene is highly similar to the v-src gene of Rous sarcoma virus. This proto-oncogene may play a role in the regulation of embryonic development and cell growth. The protein encoded by this gene is a tyrosine-protein kinase whose activity can be inhibited by phosphorylation by c-SRC kinase. Mutations in this gene could be involved in the malignant progression of colon cancer. Two transcript variants encoding the same protein have been found for this gene.
• Tag: C-His
• Molecular Mass: 9 kDa
• AA Sequence: MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAHHHHHHHH
• Endotoxin: < 1 EU/μg by LAL.
• Purity: > 90 % by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 1 mg/mL by BCA
• Storage Buffer: Sterile PBS, pH7.4

Gene Information

• Gene Name: SRC v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) [Homo sapiens (human)]
• Official Symbol: SRC
• Synonyms: SRC; v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian); SRC1, v src avian sarcoma (Schmidt Ruppin A 2) viral oncogene homolog; proto-oncogene tyrosine-protein kinase Src; ASV; c src; proto-oncogene c-Src; tyrosine kinase pp60c-src; tyrosine-protein kinase SRC-1; protooncogene SRC, Rous sarcoma; SRC1; c-SRC; p60-Src
• Gene ID: 6714
• mRNA Refseq: NM_005417
• Protein Refseq: NP_005408
• MIM: 190090
• UniProt ID: P12931