Recombinant Human v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) Protein, His-tagged
Cat.No. : | SRC-001H |
Product Overview : | Recombinant Human SRC Protein (1-79aa) with C-His-tag was expressed in E. coli. |
Availability | July 15, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-79aa |
Description : | This gene is highly similar to the v-src gene of Rous sarcoma virus. This proto-oncogene may play a role in the regulation of embryonic development and cell growth. The protein encoded by this gene is a tyrosine-protein kinase whose activity can be inhibited by phosphorylation by c-SRC kinase. Mutations in this gene could be involved in the malignant progression of colon cancer. Two transcript variants encoding the same protein have been found for this gene. |
Tag : | C-His |
Molecular Mass : | 9 kDa |
AA Sequence : | MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAHHHHHHHH |
Endotoxin : | < 1 EU/μg by LAL. |
Purity : | > 90 % by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 1 mg/mL by BCA |
Storage Buffer : | Sterile PBS, pH7.4 |
Gene Name | SRC v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) [Homo sapiens (human)] |
Official Symbol | SRC |
Synonyms | SRC; v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian); SRC1, v src avian sarcoma (Schmidt Ruppin A 2) viral oncogene homolog; proto-oncogene tyrosine-protein kinase Src; ASV; c src; proto-oncogene c-Src; tyrosine kinase pp60c-src; tyrosine-protein kinase SRC-1; protooncogene SRC, Rous sarcoma; SRC1; c-SRC; p60-Src |
Gene ID | 6714 |
mRNA Refseq | NM_005417 |
Protein Refseq | NP_005408 |
MIM | 190090 |
UniProt ID | P12931 |
◆ Native Proteins | ||
SRC-29697TH | Native Human SRC | +Inquiry |
◆ Cell & Tissue Lysates | ||
SRC-585MCL | Recombinant Mouse SRC cell lysate | +Inquiry |
SRC-487HCL | Recombinant Human SRC cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SRC Products
Required fields are marked with *
My Review for All SRC Products
Required fields are marked with *