Recombinant Human VAMP2 protein, GST-tagged
| Cat.No. : | VAMP2-218H |
| Product Overview : | Recombinant Human VAMP2 protein(NP_055047)(1-116 aa), fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-116 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
| AA Sequence : | MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). |
| Gene Name | VAMP2 vesicle-associated membrane protein 2 (synaptobrevin 2) [ Homo sapiens ] |
| Official Symbol | VAMP2 |
| Synonyms | VAMP2; vesicle-associated membrane protein 2 (synaptobrevin 2); SYB2; vesicle-associated membrane protein 2; VAMP 2; synaptobrevin 2; synaptobrevin-2; vesicle associated membrane protein 2; VAMP-2; FLJ11460; |
| Gene ID | 6844 |
| mRNA Refseq | NM_014232 |
| Protein Refseq | NP_055047 |
| MIM | 185881 |
| UniProt ID | P63027 |
| ◆ Cell & Tissue Lysates | ||
| VAMP2-438HCL | Recombinant Human VAMP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VAMP2 Products
Required fields are marked with *
My Review for All VAMP2 Products
Required fields are marked with *
