Recombinant Human VAMP5 protein, GST-tagged
Cat.No. : | VAMP5-301206H |
Product Overview : | Recombinant Human VAMP5 (1-116 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Asn116 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MAGIELERCQQQANEVTEIMRNNFGKVLERGVKLAELQQRSDQLLDMSSTFNKTTQNLAQKKCWENIRYRICVGLVVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGIASGPGN |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | VAMP5 vesicle-associated membrane protein 5 (myobrevin) [ Homo sapiens ] |
Official Symbol | VAMP5 |
Synonyms | VAMP5; vesicle-associated membrane protein 5 (myobrevin); vesicle-associated membrane protein 5; VAMP-5; myobrevin; |
Gene ID | 10791 |
mRNA Refseq | NM_006634 |
Protein Refseq | NP_006625 |
MIM | 607029 |
UniProt ID | O95183 |
◆ Recombinant Proteins | ||
VAMP5-31700TH | Recombinant Human VAMP5, His-tagged | +Inquiry |
VAMP5-6150R | Recombinant Rat VAMP5 Protein, His (Fc)-Avi-tagged | +Inquiry |
VAMP5-8167Z | Recombinant Zebrafish VAMP5 | +Inquiry |
VAMP5-6494R | Recombinant Rat VAMP5 Protein | +Inquiry |
VAMP5-5143R | Recombinant Rhesus monkey VAMP5 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
VAMP5-435HCL | Recombinant Human VAMP5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VAMP5 Products
Required fields are marked with *
My Review for All VAMP5 Products
Required fields are marked with *
0
Inquiry Basket