Recombinant Human VAMP7 Protein (2-186 aa), His-tagged
Cat.No. : | VAMP7-847H |
Product Overview : | Recombinant Human VAMP7 Protein (2-186 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cell Cycle. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 2-186 aa |
Description : | Involved in the targeting and/or fusion of transport vesicles to their target mbrane during transport of proteins from the early endosome to the lysosome. Required for heterotypic fusion of late endosomes with lysosomes and homotypic lysosomal fusion. Required for calcium regulated lysosomal exocytosis. Involved in the export of chylomicrons from the endoplasmic reticulum to the cis Golgi. Required for exocytosis of mediators during eosinophil and neutrophil degranulation, and target cell killing by natural killer cells. Required for focal exocytosis of late endocytic vesicles during phagosome formation. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 25.0 kDa |
AA Sequence : | AILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRIVYLCITDDDFERSRAFNFLNEIKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQLKHHSENKGLDKVMETQAQVDELKGIMVRNIDLVAQRGERLELLIDKTENLVDSSVTFKTTSRNLARAMCMKN |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | VAMP7 vesicle-associated membrane protein 7 [ Homo sapiens ] |
Official Symbol | VAMP7 |
Synonyms | VAMP7; TI VAMP; VAMP 7; SYBL1; TIVAMP; VAMP-7; TI-VAMP; FLJ53045; FLJ53762; FLJ54296; |
Gene ID | 6845 |
mRNA Refseq | NM_001145149 |
Protein Refseq | NP_001138621 |
MIM | 300053 |
UniProt ID | P51809 |
◆ Recombinant Proteins | ||
VAMP7-847H | Recombinant Human VAMP7 Protein (2-186 aa), His-tagged | +Inquiry |
VAMP7-5144R | Recombinant Rhesus monkey VAMP7 Protein, His-tagged | +Inquiry |
VAMP7-13H | Recombinant Human vesicle-associated membrane protein 7 Protein, His tagged | +Inquiry |
VAMP7-6151R | Recombinant Rat VAMP7 Protein, His (Fc)-Avi-tagged | +Inquiry |
VAMP7-6384H | Recombinant Human VAMP7 Protein (Met1-Met140), N-His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All VAMP7 Products
Required fields are marked with *
My Review for All VAMP7 Products
Required fields are marked with *
0
Inquiry Basket