Recombinant Mouse Vamp7 protein
| Cat.No. : | Vamp7-5123M | 
| Product Overview : | Recombinant Mouse Vamp7 protein(P70280)(2-220 aa) was expressed in E.coli. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Mouse | 
| Source : | E.coli | 
| Tag : | Non | 
| Protein Length : | 2-220 aa | 
| Form : | Tris/PBS-based buffer, 6% Trehalose. | 
| AASequence : | AILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRIV YLCITDDDFERSRAFSFLNEVKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQLKHHSENK SLDKVMETQAQVDELKGIMVRNIDLVAQRGERLELLIDKTENLVDSSVTFKTTSRNLARA MCMKNIKLTIIIIIVSIVFIYIIVSLLCGGFTWPNCVKK | 
| Purity : | >85% (SDS-PAGE) | 
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. | 
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. | 
| Gene Name | Vamp7 vesicle-associated membrane protein 7 [ Mus musculus ] | 
| Official Symbol | Vamp7 | 
| Synonyms | VAMP7; vesicle-associated membrane protein 7; synaptobrevin like 1; synaptobrevin-like protein 1; tetanus neurotoxin-insensitive vesicle-associated membrane protein; Sybl1; VAMP-7; TI-VAMP; | 
| Gene ID | 20955 | 
| mRNA Refseq | NM_011515 | 
| Protein Refseq | NP_035645 | 
| ◆ Recombinant Proteins | ||
| VAMP7-2793C | Recombinant Chicken VAMP7 | +Inquiry | 
| Vamp7-5122M | Recombinant Mouse Vamp7 protein | +Inquiry | 
| VAMP7-2330C | Recombinant Chicken VAMP7 Protein (2-181 aa), His-tagged | +Inquiry | 
| VAMP7-6384H | Recombinant Human VAMP7 Protein (Met1-Met140), N-His tagged | +Inquiry | 
| VAMP7-5144R | Recombinant Rhesus monkey VAMP7 Protein, His-tagged | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All Vamp7 Products
Required fields are marked with *
My Review for All Vamp7 Products
Required fields are marked with *
  
        
    
      
            