Recombinant Human VASH2 Protein (1-355 aa), His-SUMO-tagged

• Cat.No.: VASH2-1980H
• Product Overview: Recombinant Human VASH2 Protein (1-355 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cardiovascular. Protein Description: Full Length.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 1-355 aa
• Description: Angiogenesis inhibitor. Inhibits network formation by endothelial cells.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 56.4 kDa
• AA Sequence: MTGSAADTHRCPHPKGAKGTRSRSSHARPVSLATSGGSEEEDKDGGVLFHVNKSGFPIDSHTWERMWMHVAKVHPKGGEMVGAIRNAAFLAKPSIPQVPNYRLSMTIPDWLQAIQNYMKTLQYNHTGTQFFEIRKMRPLSGLMETAKEMTRESLPIKCLEAVILGIYLTNGQPSIERFPISFKTYFSGNYFHHVVLGIYCNGRYGSLGMSRRAELMDKPLTFRTLSDLIFDFEDSYKKYLHTVKKVKIGLYVPHEPHSFQPIEWKQLVLNVSKMLRADIRKELEKYARDMRMKILKPASAHSPTQVRSRGKSLSPRRRQASPPRRLGRREKSPALPEKKVADLSTLNEVGYQIRI
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: VASH2 vasohibin 2 [ Homo sapiens ]
• Official Symbol: VASH2
• Synonyms: VASH2; vasohibin 2; vasohibin-2; FLJ12505; RP11-275G3.1
• Gene ID: 79805
• mRNA Refseq: NM_001136474
• Protein Refseq: NP_001129946
• MIM: 610471
• UniProt ID: Q86V25