Recombinant Human VASH2 Protein (1-355 aa), His-SUMO-tagged
| Cat.No. : | VASH2-1980H |
| Product Overview : | Recombinant Human VASH2 Protein (1-355 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cardiovascular. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-355 aa |
| Description : | Angiogenesis inhibitor. Inhibits network formation by endothelial cells. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 56.4 kDa |
| AA Sequence : | MTGSAADTHRCPHPKGAKGTRSRSSHARPVSLATSGGSEEEDKDGGVLFHVNKSGFPIDSHTWERMWMHVAKVHPKGGEMVGAIRNAAFLAKPSIPQVPNYRLSMTIPDWLQAIQNYMKTLQYNHTGTQFFEIRKMRPLSGLMETAKEMTRESLPIKCLEAVILGIYLTNGQPSIERFPISFKTYFSGNYFHHVVLGIYCNGRYGSLGMSRRAELMDKPLTFRTLSDLIFDFEDSYKKYLHTVKKVKIGLYVPHEPHSFQPIEWKQLVLNVSKMLRADIRKELEKYARDMRMKILKPASAHSPTQVRSRGKSLSPRRRQASPPRRLGRREKSPALPEKKVADLSTLNEVGYQIRI |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name | VASH2 vasohibin 2 [ Homo sapiens ] |
| Official Symbol | VASH2 |
| Synonyms | VASH2; vasohibin 2; vasohibin-2; FLJ12505; RP11-275G3.1; |
| Gene ID | 79805 |
| mRNA Refseq | NM_001136474 |
| Protein Refseq | NP_001129946 |
| MIM | 610471 |
| UniProt ID | Q86V25 |
| ◆ Recombinant Proteins | ||
| Vash2-6899M | Recombinant Mouse Vash2 Protein, Myc/DDK-tagged | +Inquiry |
| VASH2-9997M | Recombinant Mouse VASH2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| VASH2-3140Z | Recombinant Zebrafish VASH2 | +Inquiry |
| VASH2-3127H | Recombinant Human VASH2 protein, His-tagged | +Inquiry |
| VASH2-1980H | Recombinant Human VASH2 Protein (1-355 aa), His-SUMO-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| VASH2-427HCL | Recombinant Human VASH2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VASH2 Products
Required fields are marked with *
My Review for All VASH2 Products
Required fields are marked with *
