Recombinant Human VAX1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | VAX1-5449H |
Product Overview : | VAX1 MS Standard C13 and N15-labeled recombinant protein (NP_954582) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a homeo-domain containing protein from a class of homeobox transcription factors which are conserved in vertebrates. Genes of this family are involved in the regulation of body development and morphogenesis. The most conserved genes, called HOX genes are found in special gene clusters. This gene belongs to the VAX subfamily and lies in the vicinity of the EMX homeobox gene family. Another member of VAX family is located on chromosome 2. The encoded protein may play an important role in the development of anterior ventral forebrain and visual system. Multiple transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 21 kDa |
AA Sequence : | MFGKPDKMDVRCHSDAEAARVSKNAHKESRESKGAEGNLPAAFLKEPQGAFSASGAAEDCNKSKSNSAADPDYCRRILVRDAKGSIREIILPKGLDLDRPKRTRTSFTAEQLYRLEMEFQRCQYVVGRERTELARQLNLSETQANSEENNERFKRGIKKQKKKRKKEPANDESRRGDSGGRGWQPLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | VAX1 ventral anterior homeobox 1 [ Homo sapiens (human) ] |
Official Symbol | VAX1 |
Synonyms | VAX1; ventral anterior homeobox 1; MCOPS11; ventral anterior homeobox 1 |
Gene ID | 11023 |
mRNA Refseq | NM_199131 |
Protein Refseq | NP_954582 |
MIM | 604294 |
UniProt ID | Q5SQQ9 |
◆ Recombinant Proteins | ||
VAX1-17992M | Recombinant Mouse VAX1 Protein | +Inquiry |
VAX1-6362C | Recombinant Chicken VAX1 | +Inquiry |
VAX1-6503R | Recombinant Rat VAX1 Protein | +Inquiry |
VAX1-10003M | Recombinant Mouse VAX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
VAX1-6159R | Recombinant Rat VAX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
VAX1-421HCL | Recombinant Human VAX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All VAX1 Products
Required fields are marked with *
My Review for All VAX1 Products
Required fields are marked with *
0
Inquiry Basket