Recombinant Human VCAM1 protein, T7-tagged
Cat.No. : | VCAM1-179H |
Product Overview : | Recombinant human DNAL4 (463aa) fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | T7 |
Protein Length : | 463 a.a. |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGEFMGETEGKKDEADYKRLQTFPLVRHSDMPEEMRVETMELCVTACEKFSNNNESAAKMIKET MDKKFGSSWHVVIGEGFGFEITHEVKNLLYLYFGGTLAVCVWKCS |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro DNAL4 related cellular cargo movement regulation study coating with intracellular protein delivery of this protein.2. May be used as enzymatic subtrate protein for kinase and ubiquitin assay development.3. May be used for mapping DNAL4 protein-protein internaction.4. As antigen for specific antibody production. |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | VCAM1 vascular cell adhesion molecule 1 [ Homo sapiens ] |
Official Symbol | VCAM1 |
Synonyms | VCAM1; vascular cell adhesion molecule 1; vascular cell adhesion protein 1; CD106; CD106 antigen; INCAM-100; MGC99561; DKFZp779G2333; |
Gene ID | 7412 |
mRNA Refseq | NM_001078 |
Protein Refseq | NP_001069 |
MIM | 192225 |
UniProt ID | P19320 |
Chromosome Location | 1p32-p31 |
Pathway | Adaptive Immune System, organism-specific biosystem; African trypanosomiasis, organism-specific biosystem; African trypanosomiasis, conserved biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Cellular roles of Anthrax toxin, organism-specific biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; |
Function | cell adhesion molecule binding; cell adhesion molecule binding; integrin binding; |
◆ Recombinant Proteins | ||
VCAM1-5262H | Recombinant Human VCAM1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
VCAM1-5544H | Recombinant Human VCAM1 protein, His-tagged | +Inquiry |
VCAM1-2770D | Recombinant Dog VCAM1 protein, His-tagged | +Inquiry |
Vcam1-2313MAF647 | Recombinant Mouse Vcam1 Protein, Fc/His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
Vcam1-492M | Recombinant Mouse Vcam1 Protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
VCAM1-2094MCL | Recombinant Mouse VCAM1 cell lysate | +Inquiry |
VCAM1-2653MCL | Recombinant Mouse VCAM1 cell lysate | +Inquiry |
VCAM1-2439HCL | Recombinant Human VCAM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VCAM1 Products
Required fields are marked with *
My Review for All VCAM1 Products
Required fields are marked with *