Recombinant Human VCAM1 protein, T7-tagged

Cat.No. : VCAM1-179H
Product Overview : Recombinant human DNAL4 (463aa) fused with T7 Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : T7
Protein Length : 463 a.a.
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGEFMGETEGKKDEADYKRLQTFPLVRHSDMPEEMRVETMELCVTACEKFSNNNESAAKMIKET MDKKFGSSWHVVIGEGFGFEITHEVKNLLYLYFGGTLAVCVWKCS
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro DNAL4 related cellular cargo movement regulation study coating with intracellular protein delivery of this protein.2. May be used as enzymatic subtrate protein for kinase and ubiquitin assay development.3. May be used for mapping DNAL4 protein-protein internaction.4. As antigen for specific antibody production.
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name VCAM1 vascular cell adhesion molecule 1 [ Homo sapiens ]
Official Symbol VCAM1
Synonyms VCAM1; vascular cell adhesion molecule 1; vascular cell adhesion protein 1; CD106; CD106 antigen; INCAM-100; MGC99561; DKFZp779G2333;
Gene ID 7412
mRNA Refseq NM_001078
Protein Refseq NP_001069
MIM 192225
UniProt ID P19320
Chromosome Location 1p32-p31
Pathway Adaptive Immune System, organism-specific biosystem; African trypanosomiasis, organism-specific biosystem; African trypanosomiasis, conserved biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Cellular roles of Anthrax toxin, organism-specific biosystem; Cytokine Signaling in Immune system, organism-specific biosystem;
Function cell adhesion molecule binding; cell adhesion molecule binding; integrin binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All VCAM1 Products

Required fields are marked with *

My Review for All VCAM1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon