"VCAM1" Related Products

Expand
Expand
Expand

Recombinant Human VCAM1 protein, T7-tagged

Cat.No.: VCAM1-179H
Product Overview: Recombinant human DNAL4 (463aa) fused with T7 Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence: MASMTGGQQMGRGEFMGETEGKKDEADYKRLQTFPLVRHSDMPEEMRVETMELCVTACEKFSNNNESAAKMIKET MDKKFGSSWHVVIGEGFGFEITHEVKNLLYLYFGGTLAVCVWKCS
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro DNAL4 related cellular cargo movement regulation study coating with intracellular protein delivery of this protein.2. May be used as enzymatic subtrate protein for kinase and ubiquitin assay development.3. May be used for mapping DNAL4 protein-protein internaction.4. As antigen for specific antibody production.
Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name: VCAM1 vascular cell adhesion molecule 1 [ Homo sapiens ]
Official Symbol: VCAM1
Synonyms: VCAM1; vascular cell adhesion molecule 1; vascular cell adhesion protein 1; CD106; CD106 antigen; INCAM-100; MGC99561; DKFZp779G2333;
Gene ID: 7412
mRNA Refseq: NM_001078
Protein Refseq: NP_001069
MIM: 192225
UniProt ID: P19320
Chromosome Location: 1p32-p31
Pathway: Adaptive Immune System, organism-specific biosystem; African trypanosomiasis, organism-specific biosystem; African trypanosomiasis, conserved biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Cellular roles of Anthrax toxin, organism-specific biosystem; Cytokine Signaling in Immune system, organism-specific biosystem;
Function: cell adhesion molecule binding; cell adhesion molecule binding; integrin binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.