Recombinant Human VCAN protein, His-B2M & Myc-tagged

Cat.No. : VCAN-3651H
Product Overview : Recombinant Human VCAN protein(P13611)(3089-3354aa), fused to N-terminal His-B2M tag and C-terminal Myc tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : B2M&His&Myc
Protein Length : 3089-3354aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 47.6 kDa
AA Sequence : GPDRCKMNPCLNGGTCYPTETSYVCTCVPGYSGDQCELDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMN
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name VCAN versican [ Homo sapiens ]
Official Symbol VCAN
Synonyms VCAN; versican; chondroitin sulfate proteoglycan 2 , CSPG2; versican core protein; PG M; versican proteoglycan; large fibroblast proteoglycan; glial hyaluronate-binding protein; chondroitin sulfate proteoglycan 2; chondroitin sulfate proteoglycan core protein 2; WGN; ERVR; GHAP; PG-M; WGN1; CSPG2; DKFZp686K06110;
Gene ID 1462
mRNA Refseq NM_001126336
Protein Refseq NP_001119808
MIM 118661
UniProt ID P13611

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All VCAN Products

Required fields are marked with *

My Review for All VCAN Products

Required fields are marked with *

0
cart-icon
0
compare icon