Recombinant Human VCAN protein, His-B2M & Myc-tagged
| Cat.No. : | VCAN-3651H |
| Product Overview : | Recombinant Human VCAN protein(P13611)(3089-3354aa), fused to N-terminal His-B2M tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | B2M&His&Myc |
| Protein Length : | 3089-3354aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 47.6 kDa |
| AA Sequence : | GPDRCKMNPCLNGGTCYPTETSYVCTCVPGYSGDQCELDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMN |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | VCAN versican [ Homo sapiens ] |
| Official Symbol | VCAN |
| Synonyms | VCAN; versican; chondroitin sulfate proteoglycan 2 , CSPG2; versican core protein; PG M; versican proteoglycan; large fibroblast proteoglycan; glial hyaluronate-binding protein; chondroitin sulfate proteoglycan 2; chondroitin sulfate proteoglycan core protein 2; WGN; ERVR; GHAP; PG-M; WGN1; CSPG2; DKFZp686K06110; |
| Gene ID | 1462 |
| mRNA Refseq | NM_001126336 |
| Protein Refseq | NP_001119808 |
| MIM | 118661 |
| UniProt ID | P13611 |
| ◆ Recombinant Proteins | ||
| VCAN-01H | Active Recombinant Human VCAN protein, His-tagged | +Inquiry |
| VCAN-2811H | Recombinant Human VCAN Protein (3089-3354 aa), His-Myc-tagged | +Inquiry |
| VCAN-6162R | Recombinant Rat VCAN Protein, His (Fc)-Avi-tagged | +Inquiry |
| Vcan-1837M | Recombinant Mouse Vcan protein, His & T7-tagged | +Inquiry |
| VCAN-5678H | Recombinant Human VCAN Protein (Leu21-Lys347), N-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| VCAN-413HCL | Recombinant Human VCAN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VCAN Products
Required fields are marked with *
My Review for All VCAN Products
Required fields are marked with *
