Recombinant Human VCAN Protein (3089-3354 aa), His-Myc-tagged
Cat.No. : | VCAN-2811H |
Product Overview : | Recombinant Human VCAN Protein (3089-3354 aa) is produced by Baculovirus expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Signal Transduction. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His&Myc |
Protein Length : | 3089-3354 aa |
Description : | May play a role in intercellular signaling and in connecting cells with the extracellular matrix. May take part in the regulation of cell motility, growth and differentiation. Binds hyaluronic acid. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 34.6 kDa |
AA Sequence : | GPDRCKMNPCLNGGTCYPTETSYVCTCVPGYSGDQCELDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMN |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | VCAN versican [ Homo sapiens ] |
Official Symbol | VCAN |
Synonyms | VCAN; versican; versican core protein; PG M; versican proteoglycan; WGN; ERVR; GHAP; PG-M; WGN1; CSPG2; DKFZp686K06110; |
Gene ID | 1462 |
mRNA Refseq | NM_001126336 |
Protein Refseq | NP_001119808 |
MIM | 118661 |
UniProt ID | P13611 |
◆ Recombinant Proteins | ||
VCAN-3651H | Recombinant Human VCAN protein, His-B2M & Myc-tagged | +Inquiry |
VCAN-6350C | Recombinant Chicken VCAN | +Inquiry |
VCAN-5678H | Recombinant Human VCAN Protein (Leu21-Lys347), N-His tagged | +Inquiry |
VCAN-6506R | Recombinant Rat VCAN Protein | +Inquiry |
Vcan-553R | Recombinant Rat Vcan Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
VCAN-413HCL | Recombinant Human VCAN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VCAN Products
Required fields are marked with *
My Review for All VCAN Products
Required fields are marked with *