"VCAN" Related Products

Expand
Expand
Expand

Recombinant Human VCAN protein, T7/His-tagged

Cat.No.: VCAN-211H
Product Overview: Recombinant extracellular Ig-like type V domain of human VCAN cDNA (21 – 146 aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFLHKVKVGKSPPVRGSLSGKVSLPCHFSTMPTLPPSYNTSEFLRIKW SKIEVDKNGKDLKETTVLVAQNGNIKIGQDYKGRVSVPTHPEAVGDASLTVVKLLASDAGLYRCDVMYGIEDTQD TVSLT
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro non-glycosylated VCAN Ig-like V type domain mediated cell proliferation regulation study with this protein as either coating matrix protein or as soluble factor2. May be used for VCAN Ig-like V type domain protein – protein interaction assay.3. Enzymatic substrate for various proteases.4. May be used for specific antibody production.
Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name: VCAN versican [ Homo sapiens ]
Official Symbol: VCAN
Synonyms: VCAN; versican; chondroitin sulfate proteoglycan 2 , CSPG2; versican core protein; PG M; versican proteoglycan; large fibroblast proteoglycan; glial hyaluronate-binding protein; chondroitin sulfate proteoglycan 2; chondroitin sulfate proteoglycan core protein 2; WGN; ERVR; GHAP; PG-M; WGN1; CSPG2; DKFZp686K06110;
Gene ID: 1462
mRNA Refseq: NM_001126336
Protein Refseq: NP_001119808
MIM: 118661
UniProt ID: P13611
Chromosome Location: 5q12-q14
Pathway: Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Direct p53 effectors, organism-specific biosystem; Regulation of Wnt-mediated beta catenin signaling and target gene transcription, organism-specific biosystem;
Function: binding; calcium ion binding; glycosaminoglycan binding; hyaluronic acid binding; sugar binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.