Recombinant Human VCAN protein, T7/His-tagged

Cat.No. : VCAN-211H
Product Overview : Recombinant extracellular Ig-like type V domain of human VCAN cDNA (21 – 146 aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 21-146 a.a.
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MASMTGGQQMGRGHHHHHHENLYFQGGEFLHKVKVGKSPPVRGSLSGKVSLPCHFSTMPTLPPSYNTSEFLRIKW SKIEVDKNGKDLKETTVLVAQNGNIKIGQDYKGRVSVPTHPEAVGDASLTVVKLLASDAGLYRCDVMYGIEDTQD TVSLT
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro non-glycosylated VCAN Ig-like V type domain mediated cell proliferation regulation study with this protein as either coating matrix protein or as soluble factor2. May be used for VCAN Ig-like V type domain protein – protein interaction assay.3. Enzymatic substrate for various proteases.4. May be used for specific antibody production.
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name VCAN versican [ Homo sapiens ]
Official Symbol VCAN
Synonyms VCAN; versican; chondroitin sulfate proteoglycan 2 , CSPG2; versican core protein; PG M; versican proteoglycan; large fibroblast proteoglycan; glial hyaluronate-binding protein; chondroitin sulfate proteoglycan 2; chondroitin sulfate proteoglycan core protein 2; WGN; ERVR; GHAP; PG-M; WGN1; CSPG2; DKFZp686K06110;
Gene ID 1462
mRNA Refseq NM_001126336
Protein Refseq NP_001119808
MIM 118661
UniProt ID P13611
Chromosome Location 5q12-q14
Pathway Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Direct p53 effectors, organism-specific biosystem; Regulation of Wnt-mediated beta catenin signaling and target gene transcription, organism-specific biosystem;
Function binding; calcium ion binding; glycosaminoglycan binding; hyaluronic acid binding; sugar binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All VCAN Products

Required fields are marked with *

My Review for All VCAN Products

Required fields are marked with *

0

Inquiry Basket

cartIcon