Recombinant Human VCAN protein, T7/His-tagged
Cat.No. : | VCAN-211H |
Product Overview : | Recombinant extracellular Ig-like type V domain of human VCAN cDNA (21 – 146 aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 21-146 a.a. |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFLHKVKVGKSPPVRGSLSGKVSLPCHFSTMPTLPPSYNTSEFLRIKW SKIEVDKNGKDLKETTVLVAQNGNIKIGQDYKGRVSVPTHPEAVGDASLTVVKLLASDAGLYRCDVMYGIEDTQD TVSLT |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro non-glycosylated VCAN Ig-like V type domain mediated cell proliferation regulation study with this protein as either coating matrix protein or as soluble factor2. May be used for VCAN Ig-like V type domain protein – protein interaction assay.3. Enzymatic substrate for various proteases.4. May be used for specific antibody production. |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | VCAN versican [ Homo sapiens ] |
Official Symbol | VCAN |
Synonyms | VCAN; versican; chondroitin sulfate proteoglycan 2 , CSPG2; versican core protein; PG M; versican proteoglycan; large fibroblast proteoglycan; glial hyaluronate-binding protein; chondroitin sulfate proteoglycan 2; chondroitin sulfate proteoglycan core protein 2; WGN; ERVR; GHAP; PG-M; WGN1; CSPG2; DKFZp686K06110; |
Gene ID | 1462 |
mRNA Refseq | NM_001126336 |
Protein Refseq | NP_001119808 |
MIM | 118661 |
UniProt ID | P13611 |
Chromosome Location | 5q12-q14 |
Pathway | Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Direct p53 effectors, organism-specific biosystem; Regulation of Wnt-mediated beta catenin signaling and target gene transcription, organism-specific biosystem; |
Function | binding; calcium ion binding; glycosaminoglycan binding; hyaluronic acid binding; sugar binding; |
◆ Recombinant Proteins | ||
Vcan-4519M | Recombinant Mouse Vcan protein, His&Myc-tagged | +Inquiry |
VCAN-552H | Recombinant Human VCAN Protein, His-tagged | +Inquiry |
VCAN-211H | Recombinant Human VCAN protein, T7/His-tagged | +Inquiry |
Vcan-553R | Recombinant Rat Vcan Protein, His-tagged | +Inquiry |
VCAN-6162R | Recombinant Rat VCAN Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
VCAN-413HCL | Recombinant Human VCAN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VCAN Products
Required fields are marked with *
My Review for All VCAN Products
Required fields are marked with *
0
Inquiry Basket