Recombinant Human VCAN protein, T7/His-tagged

• Cat.No.: VCAN-211H
• Product Overview: Recombinant extracellular Ig-like type V domain of human VCAN cDNA (21 – 146 aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&T7
• Protein Length: 21-146 a.a.
• Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
• AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFLHKVKVGKSPPVRGSLSGKVSLPCHFSTMPTLPPSYNTSEFLRIKW SKIEVDKNGKDLKETTVLVAQNGNIKIGQDYKGRVSVPTHPEAVGDASLTVVKLLASDAGLYRCDVMYGIEDTQD TVSLT
• Purity: >90% by SDS-PAGE
• Applications: 1. May be used for in vitro non-glycosylated VCAN Ig-like V type domain mediated cell proliferation regulation study with this protein as either coating matrix protein or as soluble factor2. May be used for VCAN Ig-like V type domain protein – protein interaction assay.3. Enzymatic substrate for various proteases.4. May be used for specific antibody production.
• Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.

Gene Information

• Gene Name: VCAN versican [ Homo sapiens ]
• Official Symbol: VCAN
• Synonyms: VCAN; versican; chondroitin sulfate proteoglycan 2 , CSPG2; versican core protein; PG M; versican proteoglycan; large fibroblast proteoglycan; glial hyaluronate-binding protein; chondroitin sulfate proteoglycan 2; chondroitin sulfate proteoglycan core protein 2; WGN; ERVR; GHAP; PG-M; WGN1; CSPG2; DKFZp686K06110
• Gene ID: 1462
• mRNA Refseq: NM_001126336
• Protein Refseq: NP_001119808
• MIM: 118661
• UniProt ID: P13611
• Chromosome Location: 5q12-q14
• Pathway: Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Direct p53 effectors, organism-specific biosystem; Regulation of Wnt-mediated beta catenin signaling and target gene transcription, organism-specific biosystem
• Function: binding; calcium ion binding; glycosaminoglycan binding; hyaluronic acid binding; sugar binding