Recombinant Human VCPIP1 Protein, N-GST-tagged

• Cat.No.: VCPIP1-17H
• Product Overview: Human VCPIP1 partial ORF ( NP_079330, 1018 a.a. - 1114 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1018-1114 aa
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.41 kDa
• AA Sequence: QLHNVTAFQGKGHSLGTASGNPHLDPRARETSVVRKHNTGTDFSNSSTKTEPSVFTASSSNSELIRIAPGVVTMRDGRQLDPDLVEAQRKKLQEMVS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: VCPIP1 valosin containing protein interacting protein 1 [ Homo sapiens (human) ]
• Official Symbol: VCPIP1
• Synonyms: VCPIP1; valosin containing protein interacting protein 1; DKFZp686G038; FLJ23132; FLJ60694; KIAA1850; DUBA3; VCIP135
• Gene ID: 80124
• mRNA Refseq: NM_025054.5
• Protein Refseq: NP_079330.2
• MIM: 611745
• UniProt ID: Q96JH7