Recombinant Human VCPIP1 Protein, N-GST-tagged

Cat.No. : VCPIP1-17H
Product Overview : Human VCPIP1 partial ORF ( NP_079330, 1018 a.a. - 1114 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1018-1114 aa
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.41 kDa
AA Sequence : QLHNVTAFQGKGHSLGTASGNPHLDPRARETSVVRKHNTGTDFSNSSTKTEPSVFTASSSNSELIRIAPGVVTMRDGRQLDPDLVEAQRKKLQEMVS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name VCPIP1 valosin containing protein interacting protein 1 [ Homo sapiens (human) ]
Official Symbol VCPIP1
Synonyms VCPIP1; valosin containing protein interacting protein 1; DKFZp686G038; FLJ23132; FLJ60694; KIAA1850; DUBA3; VCIP135
Gene ID 80124
mRNA Refseq NM_025054.5 
Protein Refseq NP_079330.2
MIM 611745
UniProt ID Q96JH7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All VCPIP1 Products

Required fields are marked with *

My Review for All VCPIP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon