Recombinant Human VDAC3 protein, His-tagged
Cat.No. : | VDAC3-3182H |
Product Overview : | Recombinant Human VDAC3 protein(1-283 aa), fused to His tag, was expressed in E. coli. |
Availability | August 02, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-283 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MCNTPTYCDLGKAAKDVFNKGYGFGMVKIDLKTKSCSGVEFSTSGHAYTDTGKASGNLETKYKVCNYGLTFTQKWNTDNTLGTEISWENKLAEGLKLTLDTIFVPNTGKKSGKLKASYKRDCFSVGSNVDIDFSGPTIYGWAVLAFEGWLAGYQMSFDTAKSKLSQNNFALGYKAADFQLHTHVNDGTEFGGSIYQKVNEKIETSINLAWTAGSNNTRFGIAAKYMLDCRTSLSAKVNNASLIGLGYTQTLRPGVKLTLSALIDGKNFSAGGHKVGLGFELEA |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | VDAC3 voltage-dependent anion channel 3 [ Homo sapiens ] |
Official Symbol | VDAC3 |
Synonyms | VDAC3; voltage-dependent anion channel 3; voltage-dependent anion-selective channel protein 3; HD VDAC3; outer mitochondrial membrane protein porin 3; VDAC-3; HD-VDAC3; |
Gene ID | 7419 |
mRNA Refseq | NM_001135694 |
Protein Refseq | NP_001129166 |
MIM | 610029 |
UniProt ID | Q9Y277 |
◆ Recombinant Proteins | ||
VDAC3-3182H | Recombinant Human VDAC3 protein, His-tagged | +Inquiry |
VDAC3-155H | Recombinant Human VDAC3 Protein, GST/His-tagged | +Inquiry |
VDAC3-6168R | Recombinant Rat VDAC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
VDAC3-12447Z | Recombinant Zebrafish VDAC3 | +Inquiry |
VDAC3-6512R | Recombinant Rat VDAC3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
VDAC3-417HCL | Recombinant Human VDAC3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VDAC3 Products
Required fields are marked with *
My Review for All VDAC3 Products
Required fields are marked with *